KEGG   Taeniopygia guttata (zebra finch): 100230182Help
Entry
100230182         CDS       T01082                                 

Definition
acrosin-like
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     100230182
Peptidases [BR:tgu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100230182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 451 aa AA seqDB search
MAFPGVLSPHTSWGASAGAAASHGAGWKWLSPCRGSCGLRPLTSDEEQGRTRVVGGKSAE
AGAWPWLVSIQDPSVSGTGHLCGGSLINTQWVLTAAHCFADSRNISAMRLLIGATQLTEP
GPGAEVRLIKRLLVHKEYSSADQRNDIALLELNEPVKCSSYIQLACVPNATLDVAQLETC
YVAGWGATTARCELPEMEGNDVLQEAKVHLINVQICNSSEWYQGDIHTHNLCAGYPEGGI
DTCQGDSGGPLMCKDNSADFFWVVGVTSWGRGCARAKRPGIYTSVQHFYDWILIQMDLLP
QTDLNPTSGNVREGLQTLPRPGRAIAGTTLPPGGGRRERGRRALPWGVPGDDPGSGPGVP
GSAGTAPFLPAAAPPTPLQAAAASDTSRRCCLRHWQLLVTPDFDWVKYFPTPGRVFAQEG
SASHVCCRSLCTSCPMSLVPGRQFLMYINMH
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggccttccctggcgtgctatcgccacacacctcatggggagcttctgctggagcagca
gcaagccatggagcaggatggaaatggctttctccttgcagaggaagctgtgggctccgg
cccttgacttctgatgaggagcaaggcaggacacgcgtcgtgggtggcaaaagtgccgag
gcaggggcctggccctggcttgtcagcatccaagatccctcggtttcaggcactgggcat
ctgtgtggagggtccctcatcaacacacagtgggtcctcacagcagcccactgctttgcc
gactccaggaacatcagcgccatgcgcctgctgatcggggccacccagctgactgagccg
ggccctggggccgaggtgcgcctgattaagcggctgctggttcacaaggaatacagttct
gccgaccagaggaacgacatcgcgctgctggaactgaacgagcccgtcaagtgcagctcc
tacatccagctggcctgtgtgcccaacgccacgctggatgtggcacagctggaaacctgc
tatgtcgctggctggggtgccactacggcaagatgtgagttgccagaaatggagggcaat
gatgtcctgcaggaagccaaggtccaccttatcaatgtccagatctgcaacagcagcgag
tggtaccagggggacatccatacccacaacttgtgtgctggctacccggagggtggcatc
gacacctgccagggtgacagcgggggtccactcatgtgcaaagacaacagcgctgacttc
ttctgggttgtcggagtgaccagctgggggagaggctgcgccagagcaaaacggcctgga
atatacacttctgttcagcacttctatgactggattctcatccagatggacctacttcca
cagacggatctaaaccctacaagcgggaatgtaagggaaggattacaaaccctccctcgg
cccgggcgcgccatcgccgggacaacgctgccccctggcggcggccggcgggagcgcggg
cggcgggcgctgccctggggagtgcccggggatgatcccgggagcggcccgggagtgccc
gggagcgcgggcactgctccattcctgcccgccgccgcgcctccgacgccgctgcaggca
gccgctgcctctgacacgtcgcgtcggtgctgccttagacactggcaattactggtgaca
cctgacttcgactgggttaaatattttcccactccgggccgtgtatttgcacaggaagga
tcagcaagtcacgtctgctgccgttccctctgcaccagctgcccgatgtccttggtacct
ggccgtcagttcttaatgtacatcaacatgcactga

DBGET integrated database retrieval system