KEGG   Taeniopygia guttata (zebra finch): 100230197Help
Entry
100230197         CDS       T01082                                 

Gene name
DYRK1A
Definition
(RefSeq) dual specificity tyrosine phosphorylation regulated kinase 1A
  KO
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100230197 (DYRK1A)
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100230197 (DYRK1A)
Membrane trafficking [BR:tgu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    100230197 (DYRK1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 758 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAGQMSHSHQQYSDRRQQNISDQQVSALSYA
EQLEQPLPLTNQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQQGQGDD
SSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRVEQEWVA
IKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEMLSYNLY
DLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIV
DFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPLFSGANE
VDQMNKIVEVLGIPPTHILDQAPKARKFFEKLPDSTWNLKKTKDGKREYKPPGTRKLHNI
LGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFKKTADEG
TNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGGHFTAAV
QAMDCETHSPQVRQQFPPPIGWTATEAPTQVTVENHPVQETTFHVNPQQQNALHHHHGNS
SHHHHHHHHHHHHHGQQALGSRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSSSTTSS
STSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDMNLTVYSNPRQETGIAGHPTYQFSAN
TGPAHYMTEGHLAMRQGIDREESPMTGVCVQQSPVASS
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaggaggagagacttcagcatgcaaaccttcatctgttcggcttgcaccatcg
ttttcattccatgctgctggccttcagatggctggacagatgtcccattcgcatcagcag
tacagtgaccggcggcagcagaacatcagcgaccagcaggtctcggccttatcctacgcg
gagcagctcgagcagcccctgccactgacaaaccagaggcggatgccccaaacttttcgt
gatccagccactgctccactgaggaaactctccgtagatttgatcaaaacatacaagcat
attaatgaggtttactatgcaaaaaaaaaacggcggcatcagcagggccagggagatgat
tccagtcacaaaaaggagaggaaagtttacaatgatggttatgatgatgacaactacgac
tacattgtgaaaaatggggagaagtggatggaccgctatgaaatcgactctttaataggc
aaaggatcctttggacaggttgtgaaggcttatgaccgagtggagcaggagtgggtggcc
atcaaaatcatcaaaaacaagaaggctttcctaaaccaggcccagattgaagtgagactg
ctggagctgatgaacaaacatgacactgagatgaagtactacatagtgcatttgaagcgt
cacttcatgttcaggaaccacctgtgcttggtgtttgagatgctgtcctacaacctgtac
gacctgctgaggaacaccaacttccgcggcgtgtccctcaacctgacgcgcaagttcgcg
cagcagatgtgcacggccctgctcttcctggccacccccgagctcagcatcattcactgt
gacctaaaaccagagaacatcctgctctgcaaccccaaaaggagcgccatcaagatcgtg
gattttggcagttcgtgtcagcttggccagaggatataccaatatatccagagtcgtttt
tatcgatcaccagaggtgctactgggaatgccttatgaccttgcaattgatatgtggtcc
cttgggtgtattttggtcgagatgcacactggagagcctctctttagtggggcaaatgag
gtggatcagatgaataaaatagtggaagttctggggataccaccaacccacatcctcgac
caagcacccaaagcaagaaagttctttgagaagttgccagatagcacttggaacttgaag
aagaccaaagatggaaaaagggaatacaaaccaccgggaactcgcaaactccacaatatc
ctgggagttgagacaggagggccgggtgggcgccgtgctggggagtcaggtcatactgta
gctgactacttgaagttcaaagacctcatcttaaggatgcttgactatgaccccaagaca
cgaatccagccctactacgccctgcagcacagtttcttcaagaaaacggcggacgaaggt
accaacacgagtaacagcgtgtccacgagtcctgccatggagcagtcacagtcttcagga
accacctctagtacttcttcaagctcaggtggatcttctggcacgagcaacagcgggagg
gcgcggtcggaccccacgcaccagcatcgacacagcggtgggcacttcaccgctgctgtg
caagctatggactgtgaaacacacagcccacaggttcggcagcagtttccccctcccatc
ggctggaccgccaccgaagctcccacccaggtcaccgtcgagaaccacccggttcaagaa
accaccttccatgtaaaccctcagcaacagaacgcattacaccatcaccacggcaacagc
tcccaccaccaccaccatcaccaccaccaccaccaccaccatggacagcaagccttgggc
agccggaccaggccgagagtctacaattctccaacaaacagctcctccacccaggattct
atggaggtgggccacagtcaccactccatgacatccctgtcttcctcaactacttcttcc
tctacatcttcctcctctactggtaaccaaggcaatcaggcctatcagaaccgcccagtg
gctgctaataccttggactttggacagaacggagctatggacatgaatttaacagtctac
tctaatccgcgccaagaaactggcatagctggacatcccacgtaccagttttctgctaat
acaggtcctgctcattacatgactgaaggacaccttgccatgaggcaaggcattgataga
gaagagtctcccatgacaggagtttgtgttcagcaaagtcctgtggctagctcgtga

DBGET integrated database retrieval system