KEGG   Taeniopygia guttata (zebra finch): 100230258Help
Entry
100230258         CDS       T01082                                 

Definition
cytochrome P450 1B1-like
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100230258
  Amino acid metabolism
   00380 Tryptophan metabolism
    100230258
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100230258
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100230258
Cytochrome P450 [BR:tgu00199]
 Cytochrome P450, animal type
  CYP1 family
   100230258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 550 aa AA seqDB search
MALERLGEALRGMPPLQSSLLLLLCLLAAIHLGKLLLQHQQRRRQGQRRAPPGPFPWPLI
GNAAQLGSAPHLSFARLASTYGAVFQLRLGRWPVVVLNGERAIRQALVRQGAAFAGRPPF
PSFQLVSGGLSLAFGGYSELWKFQWRSSKTSPARRRSATVRAFFTGSPATRRMLERHLVS
EARALMALLVRGSAGGAFLDPSRVLVVAVANVMSALCFGRRYSHGDGEFLRIVGRNEQFG
RAVGAGSLVDALPWLQRFPSPVRAAYRAFRDLNRDFYGFVRGKFLQHQRSLRPGAAPRDM
MDAFIRLQREQPWLQLEHVPATVTDIFGASQDTLSTALQWLLIFLIRYPKVQAKMQEEVD
RIVGRDRLPCVEDQPHLPYIMAFLYESMRFSSFVPVTIPHATTTNTFIMGYLIPKDTVIF
VNQWSVNHDPAKWSNPEDFDPTRFLDENGLINKDLTSSVMIFSLGKRRCIGEELSKVQLF
LFTSILVHQCNFTANPNEDPKMDFTYGLTIKPKPFTLNVTLRDTMELLDQAVQRLQAEKA
ASESQLSANA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgagaggctcggggaagcgctgcgcggcatgcccccgttgcaaagctccctc
ctgcttctcctctgcctgctcgccgccatccacctgggcaagctcctcctgcagcatcag
cagcgccggcggcaaggccagcgccgggcaccgccgggccctttcccctggcccctgatc
ggcaacgcggcgcagctgggcagcgccccgcacctctccttcgcccggctggccagcacc
tacggcgccgtgttccagctgcgcctggggcgctggcccgtggtggtgctgaacggggag
cgcgccatccgccaggccctcgtccgccagggggccgccttcgcgggccgcccgcccttc
ccgtccttccagctggtgtcgggcgggctcagcctggccttcggcggatactcggagctc
tggaaatttcaatggaggagctctaaaacctcaccggcacgccggcgcagcgccacggtg
cgagccttcttcacgggcagtcccgccacccgccgcatgctggagcgacacctggtgagc
gaggcgcgggcgctgatggcgctgctggtgcgcggcagcgccggcggcgccttcctagac
ccctcgcgcgtcctggtggtggccgtggccaacgtgatgagcgccctgtgcttcggccgc
cgctacagccacggcgacggcgagttcctgcgcatcgtggggcggaacgagcagttcggg
cgagcggtgggcgccggcagcctggtggatgcgctgccctggctccagcgcttccccagc
cccgtccgcgccgcctaccgcgccttccgcgacctcaaccgcgacttctacggcttcgtc
cgcggcaagttcctgcagcaccagcgcagcctgcgccccggggccgccccccgcgacatg
atggacgccttcatccgcctgcagcgggagcagccgtggctgcagctcgagcacgtgccc
gccaccgtcaccgacatcttcggcgccagccaggacaccctctccaccgccctgcagtgg
ctcctcatcttcctcatcaggtatccgaaagtgcaggctaaaatgcaagaagaagtggat
aggattgttggaagagaccgtctgccatgtgttgaagatcagcctcacctgccctacatc
atggctttcctgtatgaatccatgcgtttcagcagctttgtgcctgtgactatcccacac
gccaccacaaccaacaccttcatcatgggctacctcattcccaaggacactgtcatcttt
gtcaatcagtggtcagtgaatcatgacccagcaaaatggtccaacccagaggattttgat
ccaacaagattcctggatgagaatgggttgatcaataaagatctcactagcagcgtgatg
attttctcattgggaaagcgtcgatgtattggagaggagttatccaaggtacagctcttt
ctctttacctccatactggtgcatcagtgcaattttactgctaatccaaatgaggaccct
aaaatggactttacctatgggctgaccattaaacctaagccgttcactttgaatgttacg
ctccgagatacgatggagttgcttgatcaggctgtccaaagactgcaagcagagaaagca
gccagtgaaagtcagctgtcagcaaatgcttaa

DBGET integrated database retrieval system