KEGG   Taeniopygia guttata (zebra finch): 100230266Help
Entry
100230266         CDS       T01082                                 

Definition
uncharacterized LOC100230266
Orthology
K05448  
vascular endothelial growth factor A
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Cytokine-cytokine receptor interaction
mTOR signaling pathway
VEGF signaling pathway
Focal adhesion
Class
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:tgu04370]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:tgu04150]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:tgu04060]
Cellular Processes; Cell communication; Focal adhesion [PATH:tgu04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 517 aa AA seqDB search
MHEPQGYGSGVQNRGATAWRAGRRPGHHGGGGTCRSVSPRGRSDQLQSADERRAAGRALR
GTAAGGSGRAAAASAPFSKEATPARRAAGGSRREERAQEKRCTESFRANFAVSARNRASA
ARVPACPDAGRAPRTGAAVELGLPGGGGRAAAGRPRSLRSARRSAHGKQQQGPAESRAYG
GVKPETPKRNPPYPATFRSARPAAPQEAAAGTEETRARPRRGGGGSGAVARRSTAGPASR
RAPATMNFLLTWIRWGLAALLYLQSAEFCLVFSRSPFASHLLGAVRPRRWRRIWVGARST
DTCACVRAVLQRGDSAARSSAGPRGSGSALRSACAHERAPARGSRRVIKFLEVYERSFCR
TIETLVDIFQEYPDEVEYIFKPSCVPLMRCAGCCGDEGLECVPVDVYNVTMEIMRIKPHQ
SQHISHMSFLQHSKCDCRPKKDVKNKQEKKSKRGRGKGQKRKRKKGRHCEPCSERRKHLF
VQDPQTCKCSCKFTDSRCKSRQLELNERTCRCEKPRR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagccgcagggctacggctctggcgtacagaaccgcggggctacggcttggagg
gcggggaggaggccgggccatcacggaggaggtgggacttgccggagcgtctctccccgt
ggccgctccgatcagttgcagagtgctgacgagcggcgggcggcggggcgggcgctgcgc
ggaaccgccgctggagggtcgggccgagcggcggcggcatcagcccctttctccaaggag
gcgaccccggctcggagagccgccggaggcagccgccgcgaagagagggcgcaggaaaag
agatgcactgaaagtttccgcgcaaactttgctgtgagtgcgcgaaaccgagcgagcgcg
gcgcgggtgcctgcctgccccgacgcggggagagcgccgcggacgggcgccgctgtggag
ctcggactgcccggcggcgggggccgggcggcggcagggcggccgcggagcctgcgctcg
gcccggcggagcgcccacggaaagcagcagcaggggccggcggagagccgggcttatgga
ggggtgaaaccggagaccccgaagaggaaccccccttaccccgcaacctttcgcagcgcc
cgaccggcggcaccccaggaggcggcggcgggcacggaggagacgcgggcgagacctcgg
cggggcggcggcggcagcggggcggtggcgaggcggagcacggcgggccccgcttcgcgg
cgtgcgccggcaaccatgaactttctgctcacttggatccgctgggggctggcggcgctg
ctctatctgcagagcgcggagttttgtcttgtattctctcgctccccctttgcctcccac
ctgctcggtgcggtgcggccgcgccgctggcgccgaatatgggtgggtgcccgcagcaca
gacacgtgtgcgtgcgtgcgtgcggtgctgcagcggggggacagcgctgcccggagctcc
gcggggccccggggcagcggcagcgccttgcggagtgcctgcgcacatgagcgtgccccg
gcgcggggctcccggcgcgttatcaaattcctggaagtctacgagcgcagcttctgcagg
actattgagaccctggtggacattttccaggagtaccctgatgaggtggagtacatattc
aagccatcctgtgtgcctctgatgagatgtgcgggttgctgcggtgatgaaggcctagaa
tgtgtccctgtggatgtgtacaacgtcacaatggagatcatgagaattaaaccccatcag
agtcagcacatatcacacatgagcttcttacagcacagtaaatgtgactgcagaccaaag
aaagatgtcaaaaacaaacaagaaaaaaaatcaaagcgaggaagggggaagggtcaaaag
agaaagcgcaagaaaggccgtcactgtgagccttgctcagagaggagaaagcacttgttt
gtacaagatccccagacctgtaaatgttcctgcaaattcacagactcacgttgcaagtcg
aggcagcttgagttaaacgagcgcacttgcagatgtgaaaaaccgagacggtga

DBGET integrated database retrieval system