KEGG   Taeniopygia guttata (zebra finch): 100230266Help
Entry
100230266         CDS       T01082                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  
vascular endothelial growth factor A
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Cytokine-cytokine receptor interaction
mTOR signaling pathway
VEGF signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100230266 (VEGFA)
   04150 mTOR signaling pathway
    100230266 (VEGFA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100230266 (VEGFA)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100230266 (VEGFA)
Cytokines [BR:tgu04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass I
    100230266 (VEGFA)
Glycosaminoglycan binding proteins [BR:tgu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   100230266 (VEGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 445 aa AA seqDB search
MHEPQGYGSGVQNRGATAWRAGRRPGHHGGGGTCRSVSPRGRSDQLQSADERRAAGRALR
GTAAGGSGRAAAASAPFSKEATPARRAAGGSRREERAQEKRCTESFRANFAVSARNRASA
ARVPACPDAGRAPRTGAAVELGLPGGGGRAAAGRPRSLRSARRSAHGKQQQGPAESRAYG
GVKPETPKRNPPYPATFRSARPAAPQEAAAGTEETRARPRRGGGGSGAVARRSTAGPASR
RAPATMNFLLTWIRWGLAALLYLQSAELVIKFLEVYERSFCRTIETLVDIFQEYPDEVEY
IFKPSCVPLMRCAGCCGDEGLECVPVDVYNVTMEIMRIKPHQSQHISHMSFLQHSKCDCR
PKKDVKNKQEKKSKRGRGKGQKRKRKKGRYKPLSFHCEPCSERRKHLFVQDPQTCKCSCK
FTDSRCKSRQLELNERTCRCEKPRR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcacgagccgcagggctacggctctggcgtacagaaccgcggggctacggcttggagg
gcggggaggaggccgggccatcacggaggaggtgggacttgccggagcgtctctccccgt
ggccgctccgatcagttgcagagtgctgacgagcggcgggcggcggggcgggcgctgcgc
ggaaccgccgctggagggtcgggccgagcggcggcggcatcagcccctttctccaaggag
gcgaccccggctcggagagccgccggaggcagccgccgcgaagagagggcgcaggaaaag
agatgcactgaaagtttccgcgcaaactttgctgtgagtgcgcgaaaccgagcgagcgcg
gcgcgggtgcctgcctgccccgacgcggggagagcgccgcggacgggcgccgctgtggag
ctcggactgcccggcggcgggggccgggcggcggcagggcggccgcggagcctgcgctcg
gcccggcggagcgcccacggaaagcagcagcaggggccggcggagagccgggcttatgga
ggggtgaaaccggagaccccgaagaggaaccccccttaccccgcaacctttcgcagcgcc
cgaccggcggcaccccaggaggcggcggcgggcacggaggagacgcgggcgagacctcgg
cggggcggcggcggcagcggggcggtggcgaggcggagcacggcgggccccgcttcgcgg
cgtgcgccggcaaccatgaactttctgctcacttggatccgctgggggctggcggcgctg
ctctatctgcagagcgcggagttagttatcaaattcctggaagtctacgagcgcagcttc
tgcaggactattgagaccctggtggacattttccaggagtaccctgatgaggtggagtac
atattcaagccatcctgtgtgcctctgatgagatgtgcgggttgctgcggtgatgaaggc
ctagaatgtgtccctgtggatgtgtacaacgtcacaatggagatcatgagaattaaaccc
catcagagtcagcacatatcacacatgagcttcttacagcacagtaaatgtgactgcaga
ccaaagaaagatgtcaaaaacaaacaagaaaaaaaatcaaagcgaggaagggggaagggt
caaaagagaaagcgcaagaaaggccggtacaaaccactcagctttcactgtgagccttgc
tcagagaggagaaagcacttgtttgtacaagatccccagacctgtaaatgttcctgcaaa
ttcacagactcacgttgcaagtcgaggcagcttgagttaaacgagcgcacttgcagatgt
gaaaaaccgagacggtga

DBGET integrated database retrieval system