KEGG   Taeniopygia guttata (zebra finch): 100230445Help
Entry
100230445         CDS       T01082                                 

Gene name
RPA2
Definition
replication protein A2, 32kDa
Orthology
K10739  
replication factor A2
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100230445 (RPA2)
   03420 Nucleotide excision repair
    100230445 (RPA2)
   03430 Mismatch repair
    100230445 (RPA2)
   03440 Homologous recombination
    100230445 (RPA2)
   03460 Fanconi anemia pathway
    100230445 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
23
AA seq 259 aa AA seqDB search
GGAGLPGGYTHSPGGFGSPAGGQAEKKQRSRSQNIVPCTVSQLLAAEQVDETFRICDVEI
SQVTVVGIVRHAEKAPTNILYKVDDMTAAPMDVRQWVDTDEAGGENVVVPPGTYVKVAGH
LRSFQNKKSLVAFKIMPLENMNEFTTHILEIVNAHMILRKNLMSASRGPQSFSSTGISDM
GGYGGGGSLPVNGLTAHQSQVLNLIKSCHVPEGMSLQDLKLQLHNMSMSTIKQAVEFLSS
EGHIYSTVDDDHYKSTDAE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ggcggcgcggggctcccgggcggctacacgcactccccgggcgggttcggctcgcccgcc
ggaggccaggcggagaagaagcagcggagccgctcgcagaacatcgtgccctgcaccgtg
tcgcagctgctggcggccgagcaggtcgacgagaccttccggatctgcgacgtggagatc
tcgcaggtcaccgtggtgggcatcgtccggcacgccgagaaggcgcccaccaacatcctc
tacaaagtggacgacatgacggcagccccgatggacgtccggcagtgggttgatactgat
gaggcaggaggtgagaatgttgtagtacctccaggaacttatgttaaagtggctggtcac
cttcgatccttccagaataagaagagcttggtagcatttaagatcatgcctctggaaaat
atgaatgagttcaccacacacatactggaaattgtcaatgcacatatgatcctcagaaaa
aatcttatgtcagcatcaagagggccacagtcattttcctccactgggataagtgacatg
gggggctacggaggaggtggcagcctgccagtgaacgggctcacagcgcaccagagccag
gtgctgaacttgatcaagagctgccatgtcccagaggggatgagtctacaggacttgaag
ctccagctccacaatatgagtatgtcaacgatcaagcaagctgtggaattcctcagcagc
gagggacacatctactccacggtggatgatgatcactataagtcgacagatgccgagtaa

DBGET integrated database retrieval system