KEGG   Taeniopygia guttata (zebra finch): 100230445Help
Entry
100230445         CDS       T01082                                 

Gene name
RPA2
Definition
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu03030  DNA replication
tgu03420  Nucleotide excision repair
tgu03430  Mismatch repair
tgu03440  Homologous recombination
tgu03460  Fanconi anemia pathway
Module
tgu_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100230445 (RPA2)
   03420 Nucleotide excision repair
    100230445 (RPA2)
   03430 Mismatch repair
    100230445 (RPA2)
   03440 Homologous recombination
    100230445 (RPA2)
   03460 Fanconi anemia pathway
    100230445 (RPA2)
DNA replication proteins [BR:tgu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    100230445 (RPA2)
DNA repair and recombination proteins [BR:tgu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     100230445 (RPA2)
   MMR (mismatch exicision repair)
     100230445 (RPA2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     100230445 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon Stn1
Motif
Other DBs
NCBI-GeneID: 100230445
NCBI-ProteinID: XP_002190972
Ensembl: ENSTGUG00000000866
Position
23
AA seq 259 aa AA seqDB search
GGAGLPGGYTHSPGGFGSPAGGQAEKKQRSRSQNIVPCTVSQLLAAEQVDETFRICDVEI
SQVTVVGIVRHAEKAPTNILYKVDDMTAAPMDVRQWVDTDEAGGENVVVPPGTYVKVAGH
LRSFQNKKSLVAFKIMPLENMNEFTTHILEIVNAHMILRKNLMSASRGPQSFSSTGISDM
GGYGGGGSLPVNGLTAHQSQVLNLIKSCHVPEGMSLQDLKLQLHNMSMSTIKQAVEFLSS
EGHIYSTVDDDHYKSTDAE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ggcggcgcggggctcccgggcggctacacgcactccccgggcgggttcggctcgcccgcc
ggaggccaggcggagaagaagcagcggagccgctcgcagaacatcgtgccctgcaccgtg
tcgcagctgctggcggccgagcaggtcgacgagaccttccggatctgcgacgtggagatc
tcgcaggtcaccgtggtgggcatcgtccggcacgccgagaaggcgcccaccaacatcctc
tacaaagtggacgacatgacggcagccccgatggacgtccggcagtgggttgatactgat
gaggcaggaggtgagaatgttgtagtacctccaggaacttatgttaaagtggctggtcac
cttcgatccttccagaataagaagagcttggtagcatttaagatcatgcctctggaaaat
atgaatgagttcaccacacacatactggaaattgtcaatgcacatatgatcctcagaaaa
aatcttatgtcagcatcaagagggccacagtcattttcctccactgggataagtgacatg
gggggctacggaggaggtggcagcctgccagtgaacgggctcacagcgcaccagagccag
gtgctgaacttgatcaagagctgccatgtcccagaggggatgagtctacaggacttgaag
ctccagctccacaatatgagtatgtcaacgatcaagcaagctgtggaattcctcagcagc
gagggacacatctactccacggtggatgatgatcactataagtcgacagatgccgagtaa

DBGET integrated database retrieval system