KEGG   Taeniopygia guttata (zebra finch): 100230521Help
Entry
100230521         CDS       T01082                                 

Gene name
RBKS
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100230521 (RBKS)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100230521 (RBKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 309 aa AA seqDB search
MAAEVVVVGSCMTDLVSLTTRLPKAGETIIGHKFFVGFGGKGANQCVQSARLGAKTSLIC
KVGSDSFGNDYVDNLKKNGISTAFVGQTTDAATGTASIIVNSEGQNVIVIVPGANLLLNF
EDLKRASDVICKAKVVVCQLEITPAVSLEALKMARASGVKTLFNPAPALADLDPQFYTYS
DIFCCNETEAEILTGIPVGNLEDAEKVGRMLLERGCKLVIVTLGAEGCMMISGDEPIPKH
VPAGKVRAVDTTGAGDSFVGALAFYLAYYPTLSMEEMIRKSNCVASVSVQAPGTQSSYPY
RKDLPQDLF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggaggtggtggtggtgggatcctgtatgaccgacctggtcagccttactaca
cgattgccaaaagctggagaaactatcattggacataagttttttgttggttttggtggg
aaaggagccaaccagtgtgtccagtctgctcgacttggggccaagacctcgctgatctgc
aaggttgggagtgattcctttggcaatgattatgttgataatttgaagaagaatggtatt
tctacagcatttgtaggtcaaactacagatgctgctactggaactgcttcaataattgtc
aacagtgaaggacagaatgttattgtcatagtcccaggagccaacctgcttttaaatttt
gaagacctgaagagggcttctgatgtcatctgtaaagccaaagtggttgtttgccagcta
gaaataacccctgctgtttctcttgaagctctgaaaatggcacgtgccagtggagtaaag
actttgtttaatccagctccagcccttgctgacctagatccacagttttatacctattct
gatatcttctgctgcaatgaaactgaggcagaaattttaacgggcatcccagttggcaac
cttgaagatgctgaaaaggtgggacgcatgctgttagaaagagggtgtaagctcgtaatt
gttactcttggagcagaaggctgcatgatgatatcaggagacgaacccattccaaagcac
gttcctgctgggaaggtcagggctgtggacactacgggcgctggagacagttttgtggga
gcactggcattctacctggcctactatcccacgttatccatggaggaaatgatcaggaag
tctaactgcgtcgcatcagtgagcgtccaggcaccggggacacaatcttcatatccttac
aggaaggacttgcctcaggaccttttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system