KEGG   Taeniopygia guttata (zebra finch): 100230601Help
Entry
100230601         CDS       T01082                                 

Gene name
PTPN5
Definition
protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched)
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tgu04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 565 aa AA seqDB search
MKDVNDNPRGPSVLEQALEPSYYVTERTECKSDGCSRPAAMESVDEAEGRQGELSRKEQS
LKASQKTAVLGWPPPWNGLIPGDNIYLFVLSQILLLCIMLWYSTYGTIPAAQNAFDLLSY
LLTPFKQVFSDQGESLTTVGSVVVSYIMLSLASLGLLFVGSLFWHLLRAPPDPPFPLQED
RRQSVSRQPSFTYSEWTEDKNEDDFLDLDPVPETPVFDCVMDIKAETDPATLTVKSVGLQ
ERRGSNVSLTLDMCTPGCSEQGFGYVMSPREQSAREYLQTASNILTEEELHKKALDPFIL
QAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSADQDDPLSSYINANYIR
GYGGEEKVYIATQGPIVNTVTDFWRMVWQERSPIIVMITNIEEMNEKCTEYWPEEQVTYE
GIEITVNRVIQADDYRLRLITLKKGEEVRNLKHYWYTSWPDQKTPDQAPPLLQLVLEVEE
AMQSAEEKNAPVIVHCSAGIGRTGCFIATSVCCKQLKNEGIVDILRTACQLRLDRGGMIQ
TCEQYQFVHHVMSLYGKQLSRAAEE
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgtaaatgataatcccagaggaccatctgtcctggagcaggcattggaacca
agttactatgtgactgaaaggactgagtgcaagtcagatggttgctcccgtccagctgct
atggagtccgtggatgaagctgaaggacggcaaggagagctgagcaggaaggagcagtcc
ctgaaagcctcccagaaaacagcagtgctcggttggcctcccccatggaatggattgata
cccggagacaacatctatctgtttgtcctctcgcagatactgcttctctgcatcatgctg
tggtacagcacttatgggactatcccagcagctcagaatgccttcgacctgctctcttac
ttgctcaccccatttaaacaggttttttcagaccaaggggagagcctgactacagttggg
agtgttgtggtatcatacatcatgctgtctttggcttctctaggactgctatttgtagga
tctttgttttggcacctcctcagagccccaccagaccctcccttcccgctgcaagaggac
agacgccagtctgtgagccggcagccttccttcacgtactcagagtggacagaggacaaa
aatgaagatgacttcctagatctggatcctgtaccagagactccagtctttgactgcgta
atggacattaaagcagagacagacccagctactctgacggttaaatccgtgggcttgcag
gaaaggagaggttcaaatgtttcactcacactggatatgtgcaccccaggctgctctgag
caaggctttggctatgtcatgtccccacgggagcagtcagcccgagaatacctccagacg
gcatcaaacatcctgactgaagaggagctgcacaagaaggcactggatcctttcatactc
caggcagagttctttgaaattccaatgaactttgttgatccaaaggaatatgatattcca
ggcttagtgcgaaagaatcgctacaaaacaattctcccaaatcctcacagcagagtgtgc
cttacctcagctgatcaggacgaccccctcagctcttacatcaatgctaactacatcagg
ggctatggaggagaggaaaaggtatatattgctactcagggaccaatagttaatactgtc
actgacttctggagaatggtgtggcaggagcgttctcccatcattgtcatgattaccaac
atagaagagatgaatgagaaatgcacagaatattggccagaggaacaggtcacctatgaa
ggaatagaaatcacagttaacagagtcatacaagcagacgattatcgtttaaggctcatc
accctaaagaaaggagaagaagtcagaaacctgaaacattactggtacacgtcttggcca
gaccagaagacaccagaccaggcccctcctctgttacagctagtactggaagtggaggag
gccatgcagagtgcagaggagaagaatgccccagtgattgttcactgcagtgcaggcatc
gggaggactggctgctttattgccacaagtgtctgctgtaaacagctgaagaacgagggc
atagttgacattttgcgaacagcctgccagttacggttagacaggggaggaatgatccag
acttgtgaacagtatcaatttgtgcatcatgtcatgagcttgtatggaaagcagctttct
agagcagcagaagaataa

DBGET integrated database retrieval system