KEGG   Taeniopygia guttata (zebra finch): 100230632Help
Entry
100230632         CDS       T01082                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100230632 (ABHD12)
Peptidases [BR:tgu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100230632 (ABHD12)
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100230632 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
3
AA seq 428 aa AA seqDB search
MAAGPLPAVEMAPRPLRGAGGKSNESVTVEHERAASAAVPGPLDKGCSLRRSLALPASAA
AEGMKRPLGRRYGLWFRLRKLILWLLGTKHPIHFYSLALMSWKRGDQKVDKNEVDQNVVP
KLWLYEETISFRFLEVRVPYFIDLKRPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAALWK
NARGKDQLWFEEALGSSHPVILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGD
SIGSPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALI
LESPFTNIREEARSHPFSVIYRYFPGFDWFFLDPITTSGIKFANDENVKYISCSLLILHA
EDDPVVPFHLGKKLYNIAATSRSFRDYKVQFVPFHTDLGYRHKYIYRSPELPRILREFLG
KSEHEHHH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgggcccttgcccgcagtagagatggcgccgcggccgctccgaggcgctggc
gggaaaagcaacgagtcggtcacggtggagcatgagcgcgccgcctctgccgccgtgccc
gggcccctcgacaagggctgcagcctgagacgaagcttggccctgcctgcctccgccgcc
gccgagggcatgaagcgtccgctgggcaggcgatatggattatggtttcgattgaggaag
ttaatactctggttgctgggaactaagcatccaatccatttctactcattggcactgatg
tcatggaaaagaggagaccaaaaggtggacaaaaatgaggtggaccaaaatgtggttccc
aaactctggctgtatgaagaaaccatctccttccggtttttagaggtgagggtcccatat
ttcattgacttgaaaagaccacaggatcaaggtttaaaccacacctgtaattattacttg
cagccagaggaggatgtaaccattggagtctggcacacggtccctgcagccttatggaag
aatgcccgagggaaggaccagctgtggtttgaagaggctttgggctccagccaccctgta
atcctttacctgcacggcaatgcaggaacaagaggaggggatcaccgggtggagctttac
aaggttctcagctcccttgggtaccatgtggtgacgtttgactatcgaggctggggtgat
tcaataggcagcccttcagagaggggaatgacctacgatgcccttcatgtcttcgactgg
ataaaagcacggagtggagacaaccctgtctatatatggggacactccctgggcacagga
gtcgcaacaaatctggtgcggcgcctctgcgagagagaaacgcccccagacgccctcatc
ctggaatctccattcaccaacatacgggaggaggcgcggagtcatcccttctctgtgata
tacagatacttccctggatttgattggttcttcctggaccccatcacaacaagtggaatt
aaatttgcaaacgatgagaatgtgaaatacatttcttgctccctactcatccttcatgct
gaggatgatccagtggtaccatttcatctgggaaaaaagctttacaacatcgcagcgacg
tcgcggagtttccgggactacaaggtgcagtttgtgcccttccacacagacctcggctac
cggcacaagtacatctacaggagtccagagctacctcggatactgcgggaattcctggga
aaatctgaacatgagcatcatcactga

DBGET integrated database retrieval system