KEGG   Taeniopygia guttata (zebra finch): 100230636Help
Entry
100230636         CDS       T01082                                 

Gene name
THBS1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:tgu04350]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:tgu04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:tgu04145]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:tgu04115]
Cellular Processes; Cell communication; Focal adhesion [PATH:tgu04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1603 aa AA seqDB search
MAATFVCQSAESRNDDNSVFDLFELIGFMRKGAGRRAPGVYLVKGPESSSPAYRIEDASR
IPAVPDSKFQDLLDAIHAEKGFILLATLRQAKKSRGTLLSVEQNDGSGHVFSLVSNGKAG
SLDLSLSVDGKQQLVSVEDVLLATGHWKNITLFVQEDRAQLYVGCEKMENAELDIPIQNI
FTRDLASSARLRIAKGGVNDNFQGLLQNVRFVFGTTLETILRNKGCSSSTSAVITLDNPI
NGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMVTTLQDRVRKVTEENEI
IAKVVQITPGACIHNGVLHKNKEEWTIDSCTECTCQNSATICRKVSCPLMPCSNATVPDG
RVLPLVLKRHQPLSMSRTRATGDTCPVPAAQRPACGSLAGAGRGCDGSTVTFLVCVPRLA
HRQTFAMGPATALCLLLLVLGGSETKRTAESRNDDNSVFDLFELIGFMRKGAGRRAPGVY
LVKGPESSSPAYRIEDASRIPAVPDSKFQDLLDAIHAEKGFILLATLRQAKKSRGTLLSV
EQNDGSGHVFSLVSNGKAGSLDLSLSVDGKQQLVSVEDVLLATGHWKNITLFVQEDRAQL
YVGCEKMENAELDIPIQNIFTRDLASSARLRIAKGGVNDNFQGLLQNVRFVFGTTLETIL
RNKGCSSSTSAVITLDNPINGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLR
SMVTTLQDRVRKVTEENEIIAKVVQITPGACIHNGVLHKNKEEWTIDSCTECTCQNSATI
CRKVSCPLMPCSNATVPDGECCPRCWPSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCD
SLNNRCEGSSVQTRTCHLQECDKRFKQDGGWSHWSPWSSCSVTCGTGIITRIRLCNSPVP
QLNGKPCEGEARENKACQKDPCPINGNWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYG
GKTCVGEARGTQVCNKQDCPIDGCLSNPCFAGAACTSAPDGSWKCGACPAGYHGDGIHCQ
DIDECKEVPDACFVFNGVHRCENTEPGYNCLPCPPRFTGTQPFGRSVEDAMSNKQVCKPR
NPCTDGTHDCNKNAKCNYLGHFSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVA
NATYHCKKDNCPNLPNSGQEDYDKDGIGDACDSDDDDDGIPDDRDNCPFIYNPQQYDYDR
DDVGDRCDNCPYNHNPDQTDTDNNGEGDACAIDIDGDGVLNERDNCQYVYNVDQRDTDLD
GVGDQCDNCPLEHNPDQEDTDSDRIGDQCDNNQDIDEDGHQNNLDNCPYVPNANQADHDK
DGKGDACDHDDDNDGIPDDKDNCRLVANPDQADSDGDGRGDACKDDFDQDSVPDIDDICP
ENVEISETDFRKFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVD
FSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQITQSYWDSTPTKAQGYSGLSIKVVN
STTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYE
GKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 4812 nt NT seq  +upstreamnt  +downstreamnt
atggctgctacctttgtgtgtcagtcagcggaatccaggaatgatgataacagcgtcttc
gatctctttgagctcattggcttcatgcggaagggagcggggcgccgggcccccggggtg
tacctggtgaagggaccagaatcctccagccctgcttaccgcattgaagatgccagtcgc
atccctgctgtccccgactcaaagttccaagacttattagatgccatccatgctgagaag
ggcttcattctcctggccactctccggcaagccaagaagagcagaggcacactgctgtct
gtggaacagaacgatggctctggtcatgtcttcagtctagtatcaaatggcaaggcaggc
tccctggacctgagcctttctgttgacggcaagcagcagttagtgtcagtagaggatgtc
ttgctagctacaggacattggaagaatatcaccctgtttgtgcaggaggaccgagctcag
ctctatgtggggtgtgagaaaatggaaaatgctgaactggacatccccatccagaacatc
ttcactagggacctggccagcagtgccaggctccgtattgccaaagggggagtcaatgac
aacttccagggtctgctgcagaatgtgcggtttgtgtttggaacaactctggaaactatc
ctgcggaacaaaggctgctccagctccactagtgcagtcattaccttggacaaccccatc
aatggttccagcccagctatccgcactaattacattggccataaaacaaaggacatccaa
gcagtctgtggattttcctgtgatgaactaacaaatatgtttgtggaactgcaagggcta
cggtccatggttacaacacttcaagacagagttcgaaaagtgactgaagaaaatgaaatc
attgccaaagtagtccagatcactcctggagcatgcattcataatggagtcttgcacaaa
aataaagaggagtggactattgacagctgcactgaatgtacttgccagaactctgccact
atatgccggaaagtgtcctgtcctctcatgccttgttccaatgccaccgtgcctgatggg
agagtgctgcccctcgtgctgaagcggcaccaaccgctctcaatgtcccgtacgagggcg
accggggacacctgccccgtccccgctgcgcaacgtcccgcctgcgggagcctcgctggc
gccggtcgtgggtgcgacggcagcacggtgaccttcctcgtgtgtgtccccaggctggct
catagacagacctttgccatggggccagcgactgctctctgcctccttctcctcgtgctc
ggcggctcagagaccaagcgcactgcagaatccaggaatgatgataacagcgtcttcgat
ctctttgagctcattggcttcatgcggaagggagcggggcgccgggcccccggggtgtac
ctggtgaagggaccagaatcctccagccctgcttaccgcattgaagatgccagtcgcatc
cctgctgtccccgactcaaagttccaagacttattagatgccatccatgctgagaagggc
ttcattctcctggccactctccggcaagccaagaagagcagaggcacactgctgtctgtg
gaacagaacgatggctctggtcatgtcttcagtctagtatcaaatggcaaggcaggctcc
ctggacctgagcctttctgttgacggcaagcagcagttagtgtcagtagaggatgtcttg
ctagctacaggacattggaagaatatcaccctgtttgtgcaggaggaccgagctcagctc
tatgtggggtgtgagaaaatggaaaacgctgaactggacatccccatccagaacatcttc
actagggacctggccagcagtgccaggctccgtattgccaaagggggagtcaatgacaac
ttccagggtctgctgcagaatgtgcggtttgtgtttggaacaactctggaaactatcctg
cggaacaaaggctgctccagctccactagtgcagtcattaccttggacaaccccatcaat
ggttccagcccagctatccgcactaattacattggccataaaacaaaggacatccaagca
gtctgtggattttcctgtgatgaactaacaaatatgtttgtggaactgcaagggctacgg
tccatggttacaacacttcaagacagagttcgaaaagtgactgaagaaaatgaaatcatt
gccaaagtagtccagatcactcctggagcatgcattcataatggagtcttgcacaaaaat
aaagaggagtggactattgacagctgcactgaatgtacttgccagaactctgccactata
tgccggaaagtgtcctgtcctctcatgccttgttccaatgccaccgtgcctgatggggag
tgctgccctcggtgctggcctagcgactatgcagacgatggatggtctccttggtctgaa
tggacctcgtgttccgtgacctgtggtaatgggattcagcagagaggccgttcctgtgac
agtctcaataaccgctgcgaaggctcctctgtacagactcggacttgccaccttcaggag
tgcgataagagatttaaacaggatggtggctggagtcactggtcgccatggtcatcatgt
tctgtcacttgtggcacgggcatcattactagaattcgtctttgcaactctccagtacca
cagctgaatggcaaaccatgtgagggtgaagcaagagaaaacaaagcctgccagaaagat
ccttgcccaattaatggcaactggggaccatggtctccatgggatgcttgcacagtgaca
tgtggaggaggacttcagaaacgaagccgtctctgcaataatcctgagcctcagtatggt
gggaagacttgtgtaggtgaagctagagggactcaggtctgcaacaaacaggactgtcca
attgatgggtgtctgtctaatccctgcttcgcgggggctgcgtgcaccagtgcccctgat
ggttcctggaagtgtggtgcctgtcctgctggctaccatggtgatggtattcactgccaa
gatattgatgagtgcaaagaggttcctgatgcctgctttgtcttcaatggagtgcacagg
tgtgagaatactgaacctgggtacaactgtctgccttgcccaccacgtttcactggaaca
cagccatttggccgcagtgtagaggatgctatgagtaacaaacaggtctgcaagccacgt
aatccatgcacagatggaacacatgactgcaacaagaatgccaaatgcaattaccttggc
cactttagtgaccccatgtatcgctgtgaatgtaaaccaggctatgctggcaatggcata
atctgtggagaagatactgacttggatggatggccaaatgagaacctggtttgtgttgcc
aatgctacttaccactgtaaaaaggataactgccctaatctgcctaactcagggcaggaa
gactatgataaggatgggattggtgatgcctgtgacagtgatgatgatgatgatggcatt
cctgatgaccgggacaactgtccattcatctacaacccacagcagtatgactatgacagg
gatgatgttggtgaccgctgtgacaactgtccctacaatcacaaccctgatcaaactgac
actgacaacaatggagaaggagatgcatgtgcaatagatattgatggagatggggtgctt
aatgaaagggacaactgccagtatgtgtacaatgtagaccagagggatacagacttggat
ggtgttggagatcagtgtgataactgtccactggaacacaaccctgaccaggaagacacc
gattctgatcgcataggtgatcagtgtgacaacaaccaggacatagatgaagatggtcat
caaaataaccttgataactgcccctatgtgcccaatgccaatcaagctgaccatgacaag
gatggaaaaggtgatgcctgtgaccatgatgatgacaatgatggtatccctgatgacaaa
gataactgcagattggttgccaacccagatcaagctgattctgatggtgatggacgtgga
gatgcttgcaaagatgactttgaccaagacagtgtgccagacattgatgatatctgccct
gaaaatgtggaaattagtgagactgatttccgaaaatttcagatgattccgctggatccc
aaaggaacatcccaaaatgatccaaactgggttgttcgtcaccagggtaaagagctggtt
cagacagtcaactgtgaccctggccttgcagtcggttttgatgaattcaatgctgtggac
ttcagtggtaccttctttatcaatacagaaagggatgatgattatgctggctttgtattt
ggctaccaatctagcagtcgtttctatgttgtcatgtggaagcagatcacccagtcttac
tgggactccacaccaaccaaagctcaaggctattcaggtctctccatcaaagttgtgaat
tctaccactggtccaggagaacaccttcgtaatgctttgtggcacacaggaaacactcct
ggccaggtgagaactttgtggcatgatcctcgtcacataggctggaaagacttcactgca
tacagatggcgacttagccatagaccaaagaccggctacatcagggttgtaatgtatgaa
gggaagaaaatcatggcagactcaggaccaatctacgataaaacctatgctggtggtcgg
ctaggattatttgtcttctctcaagaaatggtgttcttctcagaccttaaatatgaatgc
agagattcataa

DBGET integrated database retrieval system