KEGG   Taeniopygia guttata (zebra finch): 100230636Help
Entry
100230636         CDS       T01082                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  
thrombospondin 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    100230636 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100230636 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100230636 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    100230636 (THBS1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100230636 (THBS1)
Membrane trafficking [BR:tgu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100230636 (THBS1)
Cell adhesion molecules and their ligands [BR:tgu04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     100230636 (THBS1)
Glycosaminoglycan binding proteins [BR:tgu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100230636 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
5
AA seq 1177 aa AA seqDB search
MGPATALCLLLLVLGGSETKRTAESRNDDNSVFDLFELIGFMRKGAGRRAPGVYLVKGPE
SSSPAYRIEDASRIPAVPDSKFQDLLDAIHAEKGFILLATLRQAKKSRGTLLSVEQNDGS
GHVFSLVSNGKAGSLDLSLSVDGKQQLVSVEDVLLATGHWKNITLFVQEDRAQLYVGCEK
MENAELDIPIQNIFTRDLASSARLRIAKGGVNDNFQGLLQNVRFVFGTTLETILRNKGCS
SSTSAVITLDNPINGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMVTTL
QDRVRKVTEENEIIAKVVQITPGACIHNGVLHKNKEEWTIDSCTECTCQNSATICRKVSC
PLMPCSNATVPDGECCPRCWPSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRC
EGSSVQTRTCHLQECDKRFKQDGGWSHWSPWSSCSVTCGTGIITRIRLCNSPVPQLNGKP
CEGEARENKACQKDPCPINGNWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYGGKTCVG
EARGTQVCNKQDCPIDGCLSNPCFAGAACTSAPDGSWKCGACPAGYHGDGIHCQDIDECK
EVPDACFVFNGVHRCENTEPGYNCLPCPPRFTGTQPFGRSVEDAMSNKQVCKPRNPCTDG
THDCNKNAKCNYLGHFSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHC
KKDNCPNLPNSGQEDYDKDGIGDACDSDDDDDGIPDDRDNCPFIYNPQQYDYDRDDVGDR
CDNCPYNHNPDQTDTDNNGEGDACAIDIDGDGVLNERDNCQYVYNVDQRDTDLDGVGDQC
DNCPLEHNPDQEDTDSDRIGDQCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDA
CDHDDDNDGIPDDKDNCRLVANPDQADSDGDGRGDACKDDFDQDSVPDIDDICPENVEIS
ETDFRKFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFF
INTERDDDYAGFVFGYQSSSRFYVVMWKQITQSYWDSTPTKAQGYSGLSIKVVNSTTGPG
EHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMA
DSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3534 nt NT seq  +upstreamnt  +downstreamnt
atggggccagcgactgctctctgcctccttctcctcgtgctcggcggctcagagaccaag
cgcactgcagaatccaggaatgatgataacagcgtcttcgatctctttgagctcattggc
ttcatgcggaagggagcggggcgccgggcccccggggtgtacctggtgaagggaccagaa
tcctccagccctgcttaccgcattgaagatgccagtcgcatccctgctgtccccgactca
aagttccaagacttattagatgccatccatgctgagaagggcttcattctcctggccact
ctccggcaagccaagaagagcagaggcacactgctgtctgtggaacagaacgatggctct
ggtcatgtcttcagtctagtatcaaatggcaaggcaggctccctggacctgagcctttct
gttgacggcaagcagcagttagtgtcagtagaggatgtcttgctagctacaggacattgg
aagaatatcaccctgtttgtgcaggaggaccgagctcagctctatgtggggtgtgagaaa
atggaaaacgctgaactggacatccccatccagaacatcttcactagggacctggccagc
agtgccaggctccgtattgccaaagggggagtcaatgacaacttccagggtctgctgcag
aatgtgcggtttgtgtttggaacaactctggaaactatcctgcggaacaaaggctgctcc
agctccactagtgcagtcattaccttggacaaccccatcaatggttccagcccagctatc
cgcactaattacattggccataaaacaaaggacatccaagcagtctgtggattttcctgt
gatgaactaacaaatatgtttgtggaactgcaagggctacggtccatggttacaacactt
caagacagagttcgaaaagtgactgaagaaaatgaaatcattgccaaagtagtccagatc
actcctggagcatgcattcataatggagtcttgcacaaaaataaagaggagtggactatt
gacagctgcactgaatgtacttgccagaactctgccactatatgccggaaagtgtcctgt
cctctcatgccttgttccaatgccaccgtgcctgatggggagtgctgccctcggtgctgg
cctagcgactatgcagacgatggatggtctccttggtctgaatggacctcgtgttccgtg
acctgtggtaatgggattcagcagagaggccgttcctgtgacagtctcaataaccgctgc
gaaggctcctctgtacagactcggacttgccaccttcaggagtgcgataagagatttaaa
caggatggtggctggagtcactggtcgccatggtcatcatgttctgtcacttgtggcacg
ggcatcattactagaattcgtctttgcaactctccagtaccacagctgaatggcaaacca
tgtgagggtgaagcaagagaaaacaaagcctgccagaaagatccttgcccaattaatggc
aactggggaccatggtctccatgggatgcttgcacagtgacatgtggaggaggacttcag
aaacgaagccgtctctgcaataatcctgagcctcagtatggtgggaagacttgtgtaggt
gaagctagagggactcaggtctgcaacaaacaggactgtccaattgatgggtgtctgtct
aatccctgcttcgcgggggctgcgtgcaccagtgcccctgatggttcctggaagtgtggt
gcctgtcctgctggctaccatggtgatggtattcactgccaagatattgatgagtgcaaa
gaggttcctgatgcctgctttgtcttcaatggagtgcacaggtgtgagaatactgaacct
gggtacaactgtctgccttgcccaccacgtttcactggaacacagccatttggccgcagt
gtagaggatgctatgagtaacaaacaggtctgcaagccacgtaatccatgcacagatgga
acacatgactgcaacaagaatgccaaatgcaattaccttggccactttagtgaccccatg
tatcgctgtgaatgtaaaccaggctatgctggcaatggcataatctgtggagaagatact
gacttggatggatggccaaatgagaacctggtttgtgttgccaatgctacttaccactgt
aaaaaggataactgccctaatctgcctaactcagggcaggaagactatgataaggatggg
attggtgatgcctgtgacagtgatgatgatgatgatggcattcctgatgaccgggacaac
tgtccattcatctacaacccacagcagtatgactatgacagggatgatgttggtgaccgc
tgtgacaactgtccctacaatcacaaccctgatcaaactgacactgacaacaatggagaa
ggagatgcatgtgcaatagatattgatggagatggggtgcttaatgaaagggacaactgc
cagtatgtgtacaatgtagaccagagggatacagacttggatggtgttggagatcagtgt
gataactgtccactggaacacaaccctgaccaggaagacaccgattctgatcgcataggt
gatcagtgtgacaacaaccaggacatagatgaagatggtcatcaaaataaccttgataac
tgcccctatgtgcccaatgccaatcaagctgaccatgacaaggatggaaaaggtgatgcc
tgtgaccatgatgatgacaatgatggtatccctgatgacaaagataactgcagattggtt
gccaacccagatcaagctgattctgatggtgatggacgtggagatgcttgcaaagatgac
tttgaccaagacagtgtgccagacattgatgatatctgccctgaaaatgtggaaattagt
gagactgatttccgaaaatttcagatgattccgctggatcccaaaggaacatcccaaaat
gatccaaactgggttgttcgtcaccagggtaaagagctggttcagacagtcaactgtgac
cctggccttgcagtcggttttgatgaattcaatgctgtggacttcagtggtaccttcttt
atcaatacagaaagggatgatgattatgctggctttgtatttggctaccaatctagcagt
cgtttctatgttgtcatgtggaagcagatcacccagtcttactgggactccacaccaacc
aaagctcaaggctattcaggtctctccatcaaagttgtgaattctaccactggtccagga
gaacaccttcgtaatgctttgtggcacacaggaaacactcctggccaggtgagaactttg
tggcatgatcctcgtcacataggctggaaagacttcactgcatacagatggcgacttagc
catagaccaaagaccggctacatcagggttgtaatgtatgaagggaagaaaatcatggca
gactcaggaccaatctacgataaaacctatgctggtggtcggctaggattatttgtcttc
tctcaagaaatggtgttcttctcagaccttaaatatgaatgcagagattcataa

DBGET integrated database retrieval system