KEGG   Taeniopygia guttata (zebra finch): 100230636Help
Entry
100230636         CDS       T01082                                 

Gene name
THBS1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    100230636 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100230636 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100230636 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    100230636 (THBS1)
  Cell communication
   04510 Focal adhesion
    100230636 (THBS1)
Heparan sulfate/heparin binding proteins [BR:tgu00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100230636 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1603 aa AA seqDB search
MAATFVCQSAESRNDDNSVFDLFELIGFMRKGAGRRAPGVYLVKGPESSSPAYRIEDASR
IPAVPDSKFQDLLDAIHAEKGFILLATLRQAKKSRGTLLSVEQNDGSGHVFSLVSNGKAG
SLDLSLSVDGKQQLVSVEDVLLATGHWKNITLFVQEDRAQLYVGCEKMENAELDIPIQNI
FTRDLASSARLRIAKGGVNDNFQGLLQNVRFVFGTTLETILRNKGCSSSTSAVITLDNPI
NGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMVTTLQDRVRKVTEENEI
IAKVVQITPGACIHNGVLHKNKEEWTIDSCTECTCQNSATICRKVSCPLMPCSNATVPDG
RVLPLVLKRHQPLSMSRTRATGDTCPVPAAQRPACGSLAGAGRGCDGSTVTFLVCVPRLA
HRQTFAMGPATALCLLLLVLGGSETKRTAESRNDDNSVFDLFELIGFMRKGAGRRAPGVY
LVKGPESSSPAYRIEDASRIPAVPDSKFQDLLDAIHAEKGFILLATLRQAKKSRGTLLSV
EQNDGSGHVFSLVSNGKAGSLDLSLSVDGKQQLVSVEDVLLATGHWKNITLFVQEDRAQL
YVGCEKMENAELDIPIQNIFTRDLASSARLRIAKGGVNDNFQGLLQNVRFVFGTTLETIL
RNKGCSSSTSAVITLDNPINGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLR
SMVTTLQDRVRKVTEENEIIAKVVQITPGACIHNGVLHKNKEEWTIDSCTECTCQNSATI
CRKVSCPLMPCSNATVPDGECCPRCWPSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCD
SLNNRCEGSSVQTRTCHLQECDKRFKQDGGWSHWSPWSSCSVTCGTGIITRIRLCNSPVP
QLNGKPCEGEARENKACQKDPCPINGNWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYG
GKTCVGEARGTQVCNKQDCPIDGCLSNPCFAGAACTSAPDGSWKCGACPAGYHGDGIHCQ
DIDECKEVPDACFVFNGVHRCENTEPGYNCLPCPPRFTGTQPFGRSVEDAMSNKQVCKPR
NPCTDGTHDCNKNAKCNYLGHFSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVA
NATYHCKKDNCPNLPNSGQEDYDKDGIGDACDSDDDDDGIPDDRDNCPFIYNPQQYDYDR
DDVGDRCDNCPYNHNPDQTDTDNNGEGDACAIDIDGDGVLNERDNCQYVYNVDQRDTDLD
GVGDQCDNCPLEHNPDQEDTDSDRIGDQCDNNQDIDEDGHQNNLDNCPYVPNANQADHDK
DGKGDACDHDDDNDGIPDDKDNCRLVANPDQADSDGDGRGDACKDDFDQDSVPDIDDICP
ENVEISETDFRKFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVD
FSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQITQSYWDSTPTKAQGYSGLSIKVVN
STTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYE
GKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 4812 nt NT seq  +upstreamnt  +downstreamnt
atggctgctacctttgtgtgtcagtcagcggaatccaggaatgatgataacagcgtcttc
gatctctttgagctcattggcttcatgcggaagggagcggggcgccgggcccccggggtg
tacctggtgaagggaccagaatcctccagccctgcttaccgcattgaagatgccagtcgc
atccctgctgtccccgactcaaagttccaagacttattagatgccatccatgctgagaag
ggcttcattctcctggccactctccggcaagccaagaagagcagaggcacactgctgtct
gtggaacagaacgatggctctggtcatgtcttcagtctagtatcaaatggcaaggcaggc
tccctggacctgagcctttctgttgacggcaagcagcagttagtgtcagtagaggatgtc
ttgctagctacaggacattggaagaatatcaccctgtttgtgcaggaggaccgagctcag
ctctatgtggggtgtgagaaaatggaaaatgctgaactggacatccccatccagaacatc
ttcactagggacctggccagcagtgccaggctccgtattgccaaagggggagtcaatgac
aacttccagggtctgctgcagaatgtgcggtttgtgtttggaacaactctggaaactatc
ctgcggaacaaaggctgctccagctccactagtgcagtcattaccttggacaaccccatc
aatggttccagcccagctatccgcactaattacattggccataaaacaaaggacatccaa
gcagtctgtggattttcctgtgatgaactaacaaatatgtttgtggaactgcaagggcta
cggtccatggttacaacacttcaagacagagttcgaaaagtgactgaagaaaatgaaatc
attgccaaagtagtccagatcactcctggagcatgcattcataatggagtcttgcacaaa
aataaagaggagtggactattgacagctgcactgaatgtacttgccagaactctgccact
atatgccggaaagtgtcctgtcctctcatgccttgttccaatgccaccgtgcctgatggg
agagtgctgcccctcgtgctgaagcggcaccaaccgctctcaatgtcccgtacgagggcg
accggggacacctgccccgtccccgctgcgcaacgtcccgcctgcgggagcctcgctggc
gccggtcgtgggtgcgacggcagcacggtgaccttcctcgtgtgtgtccccaggctggct
catagacagacctttgccatggggccagcgactgctctctgcctccttctcctcgtgctc
ggcggctcagagaccaagcgcactgcagaatccaggaatgatgataacagcgtcttcgat
ctctttgagctcattggcttcatgcggaagggagcggggcgccgggcccccggggtgtac
ctggtgaagggaccagaatcctccagccctgcttaccgcattgaagatgccagtcgcatc
cctgctgtccccgactcaaagttccaagacttattagatgccatccatgctgagaagggc
ttcattctcctggccactctccggcaagccaagaagagcagaggcacactgctgtctgtg
gaacagaacgatggctctggtcatgtcttcagtctagtatcaaatggcaaggcaggctcc
ctggacctgagcctttctgttgacggcaagcagcagttagtgtcagtagaggatgtcttg
ctagctacaggacattggaagaatatcaccctgtttgtgcaggaggaccgagctcagctc
tatgtggggtgtgagaaaatggaaaacgctgaactggacatccccatccagaacatcttc
actagggacctggccagcagtgccaggctccgtattgccaaagggggagtcaatgacaac
ttccagggtctgctgcagaatgtgcggtttgtgtttggaacaactctggaaactatcctg
cggaacaaaggctgctccagctccactagtgcagtcattaccttggacaaccccatcaat
ggttccagcccagctatccgcactaattacattggccataaaacaaaggacatccaagca
gtctgtggattttcctgtgatgaactaacaaatatgtttgtggaactgcaagggctacgg
tccatggttacaacacttcaagacagagttcgaaaagtgactgaagaaaatgaaatcatt
gccaaagtagtccagatcactcctggagcatgcattcataatggagtcttgcacaaaaat
aaagaggagtggactattgacagctgcactgaatgtacttgccagaactctgccactata
tgccggaaagtgtcctgtcctctcatgccttgttccaatgccaccgtgcctgatggggag
tgctgccctcggtgctggcctagcgactatgcagacgatggatggtctccttggtctgaa
tggacctcgtgttccgtgacctgtggtaatgggattcagcagagaggccgttcctgtgac
agtctcaataaccgctgcgaaggctcctctgtacagactcggacttgccaccttcaggag
tgcgataagagatttaaacaggatggtggctggagtcactggtcgccatggtcatcatgt
tctgtcacttgtggcacgggcatcattactagaattcgtctttgcaactctccagtacca
cagctgaatggcaaaccatgtgagggtgaagcaagagaaaacaaagcctgccagaaagat
ccttgcccaattaatggcaactggggaccatggtctccatgggatgcttgcacagtgaca
tgtggaggaggacttcagaaacgaagccgtctctgcaataatcctgagcctcagtatggt
gggaagacttgtgtaggtgaagctagagggactcaggtctgcaacaaacaggactgtcca
attgatgggtgtctgtctaatccctgcttcgcgggggctgcgtgcaccagtgcccctgat
ggttcctggaagtgtggtgcctgtcctgctggctaccatggtgatggtattcactgccaa
gatattgatgagtgcaaagaggttcctgatgcctgctttgtcttcaatggagtgcacagg
tgtgagaatactgaacctgggtacaactgtctgccttgcccaccacgtttcactggaaca
cagccatttggccgcagtgtagaggatgctatgagtaacaaacaggtctgcaagccacgt
aatccatgcacagatggaacacatgactgcaacaagaatgccaaatgcaattaccttggc
cactttagtgaccccatgtatcgctgtgaatgtaaaccaggctatgctggcaatggcata
atctgtggagaagatactgacttggatggatggccaaatgagaacctggtttgtgttgcc
aatgctacttaccactgtaaaaaggataactgccctaatctgcctaactcagggcaggaa
gactatgataaggatgggattggtgatgcctgtgacagtgatgatgatgatgatggcatt
cctgatgaccgggacaactgtccattcatctacaacccacagcagtatgactatgacagg
gatgatgttggtgaccgctgtgacaactgtccctacaatcacaaccctgatcaaactgac
actgacaacaatggagaaggagatgcatgtgcaatagatattgatggagatggggtgctt
aatgaaagggacaactgccagtatgtgtacaatgtagaccagagggatacagacttggat
ggtgttggagatcagtgtgataactgtccactggaacacaaccctgaccaggaagacacc
gattctgatcgcataggtgatcagtgtgacaacaaccaggacatagatgaagatggtcat
caaaataaccttgataactgcccctatgtgcccaatgccaatcaagctgaccatgacaag
gatggaaaaggtgatgcctgtgaccatgatgatgacaatgatggtatccctgatgacaaa
gataactgcagattggttgccaacccagatcaagctgattctgatggtgatggacgtgga
gatgcttgcaaagatgactttgaccaagacagtgtgccagacattgatgatatctgccct
gaaaatgtggaaattagtgagactgatttccgaaaatttcagatgattccgctggatccc
aaaggaacatcccaaaatgatccaaactgggttgttcgtcaccagggtaaagagctggtt
cagacagtcaactgtgaccctggccttgcagtcggttttgatgaattcaatgctgtggac
ttcagtggtaccttctttatcaatacagaaagggatgatgattatgctggctttgtattt
ggctaccaatctagcagtcgtttctatgttgtcatgtggaagcagatcacccagtcttac
tgggactccacaccaaccaaagctcaaggctattcaggtctctccatcaaagttgtgaat
tctaccactggtccaggagaacaccttcgtaatgctttgtggcacacaggaaacactcct
ggccaggtgagaactttgtggcatgatcctcgtcacataggctggaaagacttcactgca
tacagatggcgacttagccatagaccaaagaccggctacatcagggttgtaatgtatgaa
gggaagaaaatcatggcagactcaggaccaatctacgataaaacctatgctggtggtcgg
ctaggattatttgtcttctctcaagaaatggtgttcttctcagaccttaaatatgaatgc
agagattcataa

DBGET integrated database retrieval system