KEGG   Taeniopygia guttata (zebra finch): 100230636Help
Entry
100230636         CDS       T01082                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  
thrombospondin 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    100230636 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100230636 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100230636 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    100230636 (THBS1)
  Cellular commiunity
   04510 Focal adhesion
    100230636 (THBS1)
Cell adhesion molecules and their ligands [BR:tgu04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     100230636 (THBS1)
Glycosaminoglycan binding proteins [BR:tgu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   100230636 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1177 aa AA seqDB search
MGPATALCLLLLVLGGSETKRTAESRNDDNSVFDLFELIGFMRKGAGRRAPGVYLVKGPE
SSSPAYRIEDASRIPAVPDSKFQDLLDAIHAEKGFILLATLRQAKKSRGTLLSVEQNDGS
GHVFSLVSNGKAGSLDLSLSVDGKQQLVSVEDVLLATGHWKNITLFVQEDRAQLYVGCEK
MENAELDIPIQNIFTRDLASSARLRIAKGGVNDNFQGLLQNVRFVFGTTLETILRNKGCS
SSTSAVITLDNPINGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMVTTL
QDRVRKVTEENEIIAKVVQITPGACIHNGVLHKNKEEWTIDSCTECTCQNSATICRKVSC
PLMPCSNATVPDGECCPRCWPSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRC
EGSSVQTRTCHLQECDKRFKQDGGWSHWSPWSSCSVTCGTGIITRIRLCNSPVPQLNGKP
CEGEARENKACQKDPCPINGNWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYGGKTCVG
EARGTQVCNKQDCPIDGCLSNPCFAGAACTSAPDGSWKCGACPAGYHGDGIHCQDIDECK
EVPDACFVFNGVHRCENTEPGYNCLPCPPRFTGTQPFGRSVEDAMSNKQVCKPRNPCTDG
THDCNKNAKCNYLGHFSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHC
KKDNCPNLPNSGQEDYDKDGIGDACDSDDDDDGIPDDRDNCPFIYNPQQYDYDRDDVGDR
CDNCPYNHNPDQTDTDNNGEGDACAIDIDGDGVLNERDNCQYVYNVDQRDTDLDGVGDQC
DNCPLEHNPDQEDTDSDRIGDQCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDA
CDHDDDNDGIPDDKDNCRLVANPDQADSDGDGRGDACKDDFDQDSVPDIDDICPENVEIS
ETDFRKFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFF
INTERDDDYAGFVFGYQSSSRFYVVMWKQITQSYWDSTPTKAQGYSGLSIKVVNSTTGPG
EHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMA
DSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3534 nt NT seq  +upstreamnt  +downstreamnt
atggggccagcgactgctctctgcctccttctcctcgtgctcggcggctcagagaccaag
cgcactgcagaatccaggaatgatgataacagcgtcttcgatctctttgagctcattggc
ttcatgcggaagggagcggggcgccgggcccccggggtgtacctggtgaagggaccagaa
tcctccagccctgcttaccgcattgaagatgccagtcgcatccctgctgtccccgactca
aagttccaagacttattagatgccatccatgctgagaagggcttcattctcctggccact
ctccggcaagccaagaagagcagaggcacactgctgtctgtggaacagaacgatggctct
ggtcatgtcttcagtctagtatcaaatggcaaggcaggctccctggacctgagcctttct
gttgacggcaagcagcagttagtgtcagtagaggatgtcttgctagctacaggacattgg
aagaatatcaccctgtttgtgcaggaggaccgagctcagctctatgtggggtgtgagaaa
atggaaaacgctgaactggacatccccatccagaacatcttcactagggacctggccagc
agtgccaggctccgtattgccaaagggggagtcaatgacaacttccagggtctgctgcag
aatgtgcggtttgtgtttggaacaactctggaaactatcctgcggaacaaaggctgctcc
agctccactagtgcagtcattaccttggacaaccccatcaatggttccagcccagctatc
cgcactaattacattggccataaaacaaaggacatccaagcagtctgtggattttcctgt
gatgaactaacaaatatgtttgtggaactgcaagggctacggtccatggttacaacactt
caagacagagttcgaaaagtgactgaagaaaatgaaatcattgccaaagtagtccagatc
actcctggagcatgcattcataatggagtcttgcacaaaaataaagaggagtggactatt
gacagctgcactgaatgtacttgccagaactctgccactatatgccggaaagtgtcctgt
cctctcatgccttgttccaatgccaccgtgcctgatggggagtgctgccctcggtgctgg
cctagcgactatgcagacgatggatggtctccttggtctgaatggacctcgtgttccgtg
acctgtggtaatgggattcagcagagaggccgttcctgtgacagtctcaataaccgctgc
gaaggctcctctgtacagactcggacttgccaccttcaggagtgcgataagagatttaaa
caggatggtggctggagtcactggtcgccatggtcatcatgttctgtcacttgtggcacg
ggcatcattactagaattcgtctttgcaactctccagtaccacagctgaatggcaaacca
tgtgagggtgaagcaagagaaaacaaagcctgccagaaagatccttgcccaattaatggc
aactggggaccatggtctccatgggatgcttgcacagtgacatgtggaggaggacttcag
aaacgaagccgtctctgcaataatcctgagcctcagtatggtgggaagacttgtgtaggt
gaagctagagggactcaggtctgcaacaaacaggactgtccaattgatgggtgtctgtct
aatccctgcttcgcgggggctgcgtgcaccagtgcccctgatggttcctggaagtgtggt
gcctgtcctgctggctaccatggtgatggtattcactgccaagatattgatgagtgcaaa
gaggttcctgatgcctgctttgtcttcaatggagtgcacaggtgtgagaatactgaacct
gggtacaactgtctgccttgcccaccacgtttcactggaacacagccatttggccgcagt
gtagaggatgctatgagtaacaaacaggtctgcaagccacgtaatccatgcacagatgga
acacatgactgcaacaagaatgccaaatgcaattaccttggccactttagtgaccccatg
tatcgctgtgaatgtaaaccaggctatgctggcaatggcataatctgtggagaagatact
gacttggatggatggccaaatgagaacctggtttgtgttgccaatgctacttaccactgt
aaaaaggataactgccctaatctgcctaactcagggcaggaagactatgataaggatggg
attggtgatgcctgtgacagtgatgatgatgatgatggcattcctgatgaccgggacaac
tgtccattcatctacaacccacagcagtatgactatgacagggatgatgttggtgaccgc
tgtgacaactgtccctacaatcacaaccctgatcaaactgacactgacaacaatggagaa
ggagatgcatgtgcaatagatattgatggagatggggtgcttaatgaaagggacaactgc
cagtatgtgtacaatgtagaccagagggatacagacttggatggtgttggagatcagtgt
gataactgtccactggaacacaaccctgaccaggaagacaccgattctgatcgcataggt
gatcagtgtgacaacaaccaggacatagatgaagatggtcatcaaaataaccttgataac
tgcccctatgtgcccaatgccaatcaagctgaccatgacaaggatggaaaaggtgatgcc
tgtgaccatgatgatgacaatgatggtatccctgatgacaaagataactgcagattggtt
gccaacccagatcaagctgattctgatggtgatggacgtggagatgcttgcaaagatgac
tttgaccaagacagtgtgccagacattgatgatatctgccctgaaaatgtggaaattagt
gagactgatttccgaaaatttcagatgattccgctggatcccaaaggaacatcccaaaat
gatccaaactgggttgttcgtcaccagggtaaagagctggttcagacagtcaactgtgac
cctggccttgcagtcggttttgatgaattcaatgctgtggacttcagtggtaccttcttt
atcaatacagaaagggatgatgattatgctggctttgtatttggctaccaatctagcagt
cgtttctatgttgtcatgtggaagcagatcacccagtcttactgggactccacaccaacc
aaagctcaaggctattcaggtctctccatcaaagttgtgaattctaccactggtccagga
gaacaccttcgtaatgctttgtggcacacaggaaacactcctggccaggtgagaactttg
tggcatgatcctcgtcacataggctggaaagacttcactgcatacagatggcgacttagc
catagaccaaagaccggctacatcagggttgtaatgtatgaagggaagaaaatcatggca
gactcaggaccaatctacgataaaacctatgctggtggtcggctaggattatttgtcttc
tctcaagaaatggtgttcttctcagaccttaaatatgaatgcagagattcataa

DBGET integrated database retrieval system