KEGG   Taeniopygia guttata (zebra finch): 100230709Help
Entry
100230709         CDS       T01082                                 

Gene name
FLNB
Definition
filamin B, beta
Orthology
K04437  
filamin
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tgu04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:tgu04510]
Human Diseases; Infectious diseases; Salmonella infection [PATH:tgu05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 2633 aa AA seqDB search
MPATEKDLAEDAPWKRIQQNTFTRWCNEHLRCVNKRIGNLQHDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLERESIKLVSIDSKAIVDGNLKLILGLIWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWETWDPKKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPHGNMVKQPAIFTVDTISAGQGDLMVFIEDPEGNR
EEAKITPSSDKNKTYSVQYVPRVTGPHKVSVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEAAGNIANKPTYFDLYTAGAGVGDVIVEVEDPQGRSLAEVVVEDKGNQVYRCTYKP
VQAGPHIVKVTFAGEAIPKTPCTVLIGEACNPNACRATGRGLQPKGVRIRETADFKVDTR
AAGSGDLGVIIKGPKGLEELVKQKGFMDGIYAFEYYPATPGKYVVTITWGGQNIPKSPFE
VQVGHEAGPQKVRAWGPGLHEGVVGKSADFVVESIGTEVGSLGFAIEGPSQAKIECDDKN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIRPASGDFNADKVKAYGPGLERTGC
IVNNPAEFTVETKDAGKAPLKMYAQDGEGNPIDIQIKSKPDGVFACSYVPVKPIKHTISV
VWGGANVPNSPFRVLIGQGSHPQKVKVFGPGVERTGLKASEPTHFTVDCTDAGEGDVSVG
IKCDARVVSSEEEDIDFDIIHNANDTFTVKYSPPAAGRYTIKVLFAGEEIPASPFRVKVD
PSHDASKVKAEGPGLNKTGVENGKPTHFTVFTKGAGKAPLDVQFSSSVPGEAVMDLDIID
NYDYSHTIRYTPIQQGPMKVLVTYGGDPIPKSPFTVGVAAPLDLSKVIVNGLENRVEVGK
DQEFVIDTKGAGGQGKLEVNISSPMRKAVPCLVEPVLGKECSTAKYIPREEGLYVVDVSY
DGNPIPGSPYTVEATLPPDPSKVKAHGPGLRGGLVGKPAQFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDVSKVIATG
PGLERGKVGEAGLLNVDCTEAGPGDLRVDMVSDTGSKAEVQIDDNKDGTYVVTYVPLSAG
MYTIKMRYGGEQVPKFPARVKVEPAVDTSRVKVFGPGVEGKDVFREATTEFTVDARPLTK
AGGDHIRTQITSPSGSPTDCLIQDNADGTYSVEYTPFEKGPHSVSVTYDGVPVPNSPFRV
NVAEGCHPSRVKAQGPGLTEAFTNQPNAFSVVTRGAGIGGLGITVEGPSESKISCKDNKD
GSCSAEYIPYVPGDYDVNITYGGEHIPGSPFKVPVKDVVDPSKVKIAGPGLGTAVRAKIP
QSFTVDTSKAGIAPLEVVVTGPRVDETDSQGWRSPLKAISDFFKGGPKGDSETGVVGPVN
VVDNGDGTHTVVYTPMQEGPYMITVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSY
GILASLPVEFAVDAKDAGQGLLAVQITDQEGKPKRVDIHDNKDGTYMVTYVPDKTGRYTI
GVKYGGDDIPASPYRIRASPAGDASKCLATGPGIAPTVKTGEEVGFVVDAKSAGKGKVTC
TVLTPDGTEAEADVVENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMAVDADDV
AAQSQEPVGASPPGFRPWVTEEAYVPVGDMNGMGFRPFDMVIPFAVRKGEITGEVHMPSG
KMDTPDIVDNKDGTVTVKYAPTEVGLHEMHIKYMGNHIPESPLQFYVNYPNSGSVSAYGP
GLIYGIANKPATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGNYS
ILVKYNDKHIPGSPFTAKITDDNRRRSQVKLGSAADFMLDINETDLSLLTASIKAPSGRD
EPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGSHVPNSPVTIMVVQSEIGDARRARVFG
RGLVEGRTFEMCDFIVDTRDAGYGGISLAVEGPSKVEIQTEDLEDGTCKVSYFPTVPGVY
IVSTKFADEHIPGSPFSVKISGEGRVKESITRTRRAPSVATVGSICDLNLKIPEIDCADM
TAQVTSPSGRNFDAEIVECDKNTYCVRFVPQEMGVHTVDVKYKGQPVPGSPFQFTVGPLG
EGGAHKVRAGGPGLERGETGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKDGSCG
ASYIVQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVTSLQESGLKVNQPASFA
IRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGS
PFKVRVGEPGQAGNPALVTAYGSGLESGTTGLQSEFFINTTKAGPGTLSVTIEGPSKVKM
DCQETPEGYKVMYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSIL
VESVTRSSTETCYSAIPKSTSDASKVVSRGAGLSKAFVGQKSSFSVDCSKAGSNMLLVGV
HGPTIPCEEVSIKHLGSHQYNVTYVVKERGDYVLAVKWGDEHIPGSPFHVTVP
NT seq 7902 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccaccgagaaggacctggcggaggacgcgccttggaagcggatccagcagaac
accttcacccgctggtgtaacgagcacctgcgctgcgtcaacaagcgcatcggcaacctg
cagcatgacctgagcgatgggctgcggctgatcgcgctgctggaggtgctcagccagaag
cgcatgtaccgcaagtaccaccagcggcccaccttccgccagatgcagctggagaacgtc
tcggtggccctcgagttcctggagcgggagagcatcaagctggtctccatcgatagtaaa
gccatagttgatggaaacctgaagctgatccttggcctgatatggacccttatccttcac
tactccatttctatgcctgtttgggaggatgaaggtgatgatgatgcaaagaagcagacc
cctaagcagaggctgctgggctggatccagaacaaaattccttacttgccaatcacaaac
ttcaatcagaactggcaggatggcaaagcactgggtgctcttgttgacagctgtgctcca
ggtttgtgccctgactgggagacctgggacccaaagaagcccgtggacaatgcccgggaa
gccatgcagcaggcggatgactggctgggtgtaccacaggttattacccctgaagaaatt
atccaccctgatgtggatgagcactctgtgatgacttacctgtcccagttccccaaagcc
aagctgaaaccaggagctcctttaaaacccaaactgaatccaaagaaagcaagggcttat
ggcagagggattgagcctcatgggaacatggtgaagcagcctgccatcttcacagtggac
accatcagtgctgggcagggtgacctgatggtcttcatagaagatccagaaggaaacaga
gaggaggcaaagataacgccatccagtgacaaaaacaagacctactcagtacagtatgtt
ccaagggttactggacctcacaaggtttcagtcctgtttgctgggcagcacatctcaaag
agtccatttgaagtgaatgttgacaaagcccagggagatgcaagcaaagtgacagcaaag
ggaccaggactggaggcagcagggaacattgccaataaacctacctactttgacctttac
acagcaggtgctggtgtgggtgacgtgattgtggaagtggaggatcctcagggaagaagc
cttgctgaagttgtagtggaagacaaaggcaaccaagtctaccgttgcacctataaacct
gttcaagctggtcctcacattgtcaaagtgacttttgctggggaggcaattcccaaaact
ccttgcactgttctcattggagaggcctgcaaccccaacgcgtgtcgtgccactggtcga
ggcctgcagcccaagggcgtccgcatcagggagacggccgacttcaaggttgatacaaga
gcagcagggagcggagatcttggagtgattatcaagggaccaaagggcttggaggagttg
gtgaaacaaaaaggctttatggatggtatatatgcatttgaatattacccagccacgcca
gggaagtacgttgtcacaattacatggggtgggcaaaacatcccaaaaagtccctttgaa
gttcaggtgggtcatgaagcaggtcctcagaaagtgcgagcctgggggccaggactgcac
gagggagttgtgggcaagtcggctgactttgtggtcgagtccattggcacagaagttggt
tctcttggctttgcaatagaaggcccttctcaggctaaaattgagtgtgatgacaagaat
gatggctcatgtgatgtgaagtattggcccaaggagcctggtgaatatgctgtgcacatc
atgtgtgatgatgaggacataaaagacagcccttacatggcctttattcgaccagcttca
ggagacttcaatgcggataaggtgaaggcttatggcccgggcttggagaggactggctgt
atagtgaacaatcctgccgagttcacagttgaaaccaaggatgctgggaaagcacctctg
aagatgtatgcacaggatggagaaggaaaccctattgatatccagataaagagcaagcct
gatggtgtatttgcctgctcctatgtgccagttaaaccaatcaaacatacaatttctgtt
gtctggggaggagccaatgtgcccaatagcccatttagggtccttataggtcaagggagt
catcctcagaaagtcaaagtgtttggacctggcgtggagagaactggcctgaaggcaagt
gagccaacccacttcactgtggactgcacagatgcaggagaaggtgatgtcagtgtggga
atcaagtgtgatgctcgtgtggtcagcagtgaggaagaggacatagattttgacatcatc
cacaatgctaatgatacattcacagtgaagtactcaccacccgctgccgggcgctacact
attaaagtgctttttgcaggagaggaaattcctgccagcccattcagagttaaggtggac
ccctcacacgatgccagcaaagtgaaagctgaaggacctgggctgaacaaaactggtgtg
gaaaatggcaaaccaacacacttcactgtgttcaccaagggggctggaaaagctccactg
gatgtgcagttcagcagctcagtgccaggagaggcagtgatggatctggatatcattgac
aactatgactattcccacactattaggtacacgcccatacagcagggtccaatgaaggtt
ttggtaacttatggcggtgatcctatccctaaaagccctttcacagtgggcgttgctgct
cctctagacctaagcaaagttatagtcaatggactcgaaaacagagtggaagtagggaag
gatcaggaatttgtaattgataccaaaggagctggtgggcaaggtaaactggaggttaat
atttccagtcctatgagaaaagctgtgccatgtctggtggaaccagttctgggtaaggag
tgcagcactgcaaaatatatcccacgggaagaaggactgtatgtggtggatgtgagttat
gatggcaacccaatcccagggagcccctacactgtggaggccacactacctccagaccct
tccaaggtaaaagctcatggtccaggtcttcgagggggtcttgttggaaaaccagcccag
tttacaatagataccaaaggggcaggaactggaggtttgggtttgacagtggaaggcccg
tgcgaagctaaaattgaatgttcggacaacggcgatggaacctgctctgtctcctacctg
cctacgaagcctggagagtattttgtaaacatcctctttgaagaagttcacattcctggt
tcgccctttaaggcagatatagaaatgccatttgatgtgtctaaagtcattgccacaggc
ccaggtctggagcgtggtaaagtaggcgaggcagggctgctgaatgtcgactgcacggaa
gcaggtcctggggacctgcgggtggacatggtgtcagatactggttccaaagctgaggtc
cagatcgatgataacaaagatgggacctatgttgttacctacgttccactctcagctggc
atgtacacaatcaagatgagatatggaggagagcaagtgccgaaattcccagcccgggtc
aaagtggagccagctgtggacacaagcagagttaaagtgtttgggccaggagtcgaagga
aaagatgtcttccgagaagctacaactgagttcactgtggatgctcgacctctaacaaag
gctggtggtgaccacatcaggacacagatcacgagcccatctggctcccccacagactgt
ctcatccaagacaacgcggatggaacatattcagtggagtacacgccatttgaaaagggt
ccgcactcagtcagcgtgacatacgacggtgtgcctgtgccaaacagtcccttcagagtg
aatgttgcagagggctgccacccatcacgtgtgaaggcacaaggacctggacttacagaa
gctttcacaaatcagcccaatgccttttcagttgtcaccagaggagcaggaattggtggc
cttggaataactgttgaaggaccttcagaatctaaaattagctgtaaagataacaaggat
gggagctgcagtgccgagtatattccttatgttccaggagattacgatgttaacatcacg
tatgggggagagcatattcctggcagtcctttcaaggttcctgtgaaggatgttgtggat
cccagcaaggtgaagatagcaggaccaggtctgggtacagctgttcgagccaaaatcccc
cagtccttcactgtggacaccagcaaagcaggaatagcacctcttgaagtggtggtgaca
ggacccagagtggatgagacggattcccagggatggcgctccccattgaaagcaatttcg
gatttctttaaaggtggtccaaagggtgactctgagacaggagttgtgggacctgttaat
gtggtagacaatggagatggcacccacacagtggtgtacacccctatgcaggagggaccg
tacatgatcactgtcaaatatgctgatgaagagattcctcgaagtcccttcaaggtgaag
gtgcttcctacgtacgatgccagtaaagtgacagcgagtggtccagggctcagttcctat
ggcattctagccagcctgcctgtggagtttgctgtggatgctaaggatgctgggcaggga
cttctggctgtacagatcacggaccaagagggcaaacccaagagagtggacattcatgac
aacaaggatggcacttacatggtcacctacgtccctgacaaaactggccgctatacgatt
ggcgttaagtatggtggagatgacattccggcctccccctacaggatccgggcatctcca
gctggggatgccagcaagtgtttggccacaggtcctggaattgcacccactgtgaagact
ggtgaggaggttggttttgtggtagacgccaaatcagcagggaagggaaaagtgacgtgt
accgtcctcacgccagatgggacagaagctgaagcagatgttgttgaaaatgaggatggg
acttacgatatcttctacactgctgccaaaccaggaacctatgtgatttatgtccgcttt
ggtggggtggacattcccaacagtcctttcactgtcatggctgtagatgcagatgacgtt
gccgcacagtcgcaggagccagtgggcgcttccccgcccggattccgcccttgggttaca
gaagaagcttacgtccccgttggagacatgaacggcatggggttcaggccctttgatatg
gttatcccatttgctgtaaggaaaggagaaataacaggtgaagtacacatgccctctgga
aagatggatacaccagatatcgtggataataaagatggcacagtaacagtgaaatatgct
cctactgaggttgggctccatgaaatgcacataaaatacatgggaaatcacatcccagag
agccctctgcagttctatgtcaattaccccaacagcggtagtgtgtctgcttatgggcct
ggcctcatttatgggattgctaataaaccagcaactttcaccattgtcacagaagatgca
ggagagggtgggctggacttggctattgaaggaccttcaaaagcagagatcagttgcatt
gataacaaagatgggacatgcacagtcacgtacctccctacactacctgggaactacagc
atcctggtaaaatacaatgacaaacacattccgggcagtccattcacagccaagatcaca
gatgataacagaagacggtctcaggttaagcttggttctgctgctgacttcatgttggat
atcaatgagactgatctcagtctcctaacagccagcattaaagccccatctggtcgtgat
gagccttgtcttctgaagaggctgcccaataaccacattggcatctcattcattccacgg
gaagtaggagaacatctggttagcatcaagaaaaatgggagccatgtaccaaacagccct
gtaacaatcatggtggtccagtctgagatcggggatgccagacgggcaagagtttttggg
cgtggcttggtagaaggacgaacctttgaaatgtgtgacttcattgtagacacaagagat
gccggttatggtgggatctcactggcagttgaaggacccagcaaggtagagatccagact
gaagatctagaagatggaacttgcaaagtgtcctattttccaactgtacctggtgtgtac
attgtgtccactaaatttgcagatgaacatattccaggcagcccatttagtgtgaagata
agtggtgaaggaagagttaaggagagcatcacacgaacaagacgggctccttctgttgca
acagtaggaagcatatgtgatctgaacctaaaaatcccggaaattgattgtgctgatatg
acagctcaggtaaccagtccctctgggagaaactttgatgccgaaattgtagagtgtgac
aaaaacacctactgtgtccgctttgtgccacaagaaatgggggtccacactgtggatgtt
aaatacaaagggcagccggtgccaggcagccccttccagttcaccgtgggtccgctgggc
gagggaggagcccataaagtgagagctggaggcccggggctggagcgtggagagacaggt
gttccagctgagttcagcatatggacacgggaagctggagctggaggactgtctattgct
gtagaaggcccaagtaaagcagaaatcacctttgatgaccataaagatggatcttgtggt
gcatcatacatagttcaagagccgggcaactatgaggtgtccataaagttcaatgatgag
cacattcctgaaagcccctacctggttcctgtcatcgccccctccgatgatgctcgcagg
ctcactgtcactagtcttcaggagtctggattaaaagttaatcagccagcatcctttgct
ataaggctgaacggggcaaagggcaagattgatgctaaagtccacagcccctccggagct
gtcgaagagtgccatgtgtctgagctggagccagataaatacgccgttcggttcatcccc
cacgagaacggcatccacaccatcgatgtgaagttcaacgggagccacgtggtgggcagc
cctttcaaagtgcgtgtgggcgagcctggccaggcgggcaaccctgcccttgtcacagcc
tacggatccggcctggagagcggcaccacgggactgcagtcggagtttttcattaacacg
accaaggctggtccaggtaccctctctgttacaattgaagggccatcaaaggtgaaaatg
gactgccaggaaactccagaaggttacaaagtcatgtacacacccatggctccaggaaac
tatttaattggagttaaatatggtggacctaaccacatagtgggcagccctttcaaggca
aaggttacagggcagcgactggttagtccaggcagtgccaacgaaacctcttccatcctg
gtagagtcagtgacaaggtcatcgactgaaacttgctatagcgccattcccaaatccacc
tcggatgccagcaaagtggtttcccggggagcaggactctcaaaggcttttgtgggtcag
aaaagctccttctctgtggactgcagcaaagcaggttccaacatgctgttagttggtgtc
cacggacctacaataccatgcgaagaggtgtccatcaagcacttgggcagccatcagtac
aatgtcacttatgttgtcaaggagaggggggactatgtgctggcagtgaagtggggtgac
gagcacattcctgggagtcccttccacgtcaccgttccatag

DBGET integrated database retrieval system