KEGG   Taeniopygia guttata (zebra finch): 100230709Help
Entry
100230709         CDS       T01082                                 

Gene name
FLNB
Definition
(RefSeq) filamin-B
  KO
K04437  
filamin
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100230709 (FLNB)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100230709 (FLNB)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100230709 (FLNB)
Cytoskeleton proteins [BR:tgu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100230709 (FLNB)
  Intermediate filaments
   Intermediate filament-binding proteins
    100230709 (FLNB)
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100230709 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 2622 aa AA seqDB search
MSTQARGQGARRAADPDGEMPATEKDLAEDAPWKRIQQNTFTRWCNEHLRCVNKRIGNLQ
HDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLERESIKLVSIDSKA
IVDGNLKLILGLIWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNF
NQNWQDGKALGALVDSCAPGLCPDWETWDPKKPVDNAREAMQQADDWLGVPQVITPEEII
HPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPHGNMVKQPAIFTVDT
ISAGQGDLMVFIEDPEGNREEAKITPSSDKNKTYSVQYVPRVTGPHKVSVLFAGQHISKS
PFEVNVDKAQGDASKVTAKGPGLEAAGNIANKPTYFDLYTAGAGVGDVIVEVEDPQGRSL
AEVVVEDKGNQVYRCTYKPVQAGPHIVKVTFAGEAIPKTPCTVLIGEACNPNACRATGRG
LQPKGVRIRETADFKVDTRAAGSGDLGVIIKGPKGLEELVKQKGFMDGIYAFEYYPATPG
KYVVTITWGGQNIPKSPFEVQVGHEAGPQKVRAWGPGLHEGVVGKSADFVVESIGTEVGS
LGFAIEGPSQAKIECDDKNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIRPASG
DFNADKVKAYGPGLERTGCIVNNPAEFTVETKDAGKAPLKMYAQDGEGNPIDIQIKSKPD
GVFACSYVPVKPIKHTISVVWGGANVPNSPFRVLIGQGSHPQKVKVFGPGVERTGLKASE
PTHFTVDCTDAGEGDVSVGIKCDARVVSSEEEDIDFDIIHNANDTFTVKYSPPAAGRYTI
KVLFAGEEIPASPFRVKVDPSHDASKVKAEGPGLNKTGVENGKPTHFTVFTKGAGKAPLD
VQFSSSVPGEAVMDLDIIDNYDYSHTIRYTPIQQGPMKVLVTYGGDPIPKSPFTVGVAAP
LDLSKVIVNGLENRVEVGKDQEFVIDTKGAGGQGKLEVNISSPMRKAVPCLVEPVLGKEC
STAKYIPREEGLYVVDVSYDGNPIPGSPYTVEATLPPDPSKVKAHGPGLRGGLVGKPAQF
TIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGS
PFKADIEMPFDVSKVIATGPGLERGKVGEAGLLNVDCTEAGPGDLRVDMVSDTGSKAEVQ
IDDNKDGTYVVTYVPLSAGMYTIKMRYGGEQVPKFPARVKVEPAVDTSRVKVFGPGVEGK
DVFREATTEFTVDARPLTKAGGDHIRTQITSPSGSPTDCLIQDNADGTYSVEYTPFEKGP
HSVSVTYDGVPVPNSPFRVNVAEGCHPSRVKAQGPGLTEAFTNQPNAFSVVTRGAGIGGL
GITVEGPSESKISCKDNKDGSCSAEYIPYVPGDYDVNITYGGEHIPGSPFKVPVKDVVDP
SKVKIAGPGLGTAVRAKIPQSFTVDTSKAGIAPLEVVVTGPRGVVGPVNVVDNGDGTHTV
VYTPMQEGPYMITVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGILASLPVEFA
VDAKDAGQGLLAVQITDQEGKPKRVDIHDNKDGTYMVTYVPDKTGRYTIGVKYGGDDIPA
SPYRIRASPAGDASKCLATGPGIAPTVKTGEEVGFVVDAKSAGKGKVTCTVLTPDGTEAE
ADVVENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMAVDADDVAAQSQEPVGAS
PPGFRPWVTEEAYVPVGDMNGMGFRPFDMVIPFAVRKGEITGEVHMPSGKMDTPDIVDNK
DGTVTVKYAPTEVGLHEMHIKYMGNHIPESPLQFYVNYPNSGSVSAYGPGLIYGIANKPA
TFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGNYSILVKYNDKHIP
GSPFTAKITDDNRRRSQVKLGSAADFMLDINETDLSLLTASIKAPSGRDEPCLLKRLPNN
HIGISFIPREVGEHLVSIKKNGSHVPNSPVTIMVVQSEIGDARRARVFGRGLVEGRTFEM
CDFIVDTRDAGYGGISLAVEGPSKVEIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHI
PGSPFSVKISGEGRVKESITRTRRAPSVATVGSICDLNLKIPEIDCADMTAQVTSPSGRN
FDAEIVECDKNTYCVRFVPQEMGVHTVDVKYKGQPVPGSPFQFTVGPLGEGGAHKVRAGG
PGLERGETGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKDGSCGASYIVQEPGNY
EVSIKFNDEHIPESPYLVPVIAPSDDARRLTVTSLQESGLKVNQPASFAIRLNGAKGKID
AKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGSPFKVRVGEPGQ
AGNPALVTAYGSGLESGTTGLQSEFFINTTKAGPGTLSVTIEGPSKVKMDCQETPEGYKV
MYTPMAPGNYLIGVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTET
CYSAIPKSTSDASKVVSRGAGLSKAFVGQKSSFSVDCSKAGSNMLLVGVHGPTIPCEEVS
IKHLGSHQYNVTYVVKERGDYVLAVKWGDEHIPGSPFHVTVP
NT seq 7869 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcaggcgcggggtcagggcgcgcggagagcggccgatcccgacggcgagatg
cccgccaccgagaaggacctggcggaggacgcgccttggaagcggatccagcagaacacc
ttcacccgctggtgtaacgagcacctgcgctgcgtcaacaagcgcatcggcaacctgcag
catgacctgagcgatgggctgcggctgatcgcgctgctggaggtgctcagccagaagcgc
atgtaccgcaagtaccaccagcggcccaccttccgccagatgcagctggagaacgtctcg
gtggccctcgagttcctggagcgggagagcatcaagctggtctccatcgatagtaaagcc
atagttgatggaaacctgaagctgatccttggcctgatatggacccttatccttcactac
tccatttctatgcctgtttgggaggatgaaggtgatgatgatgcaaagaagcagacccct
aagcagaggctgctgggctggatccagaacaaaattccttacttgccaatcacaaacttc
aatcagaactggcaggatggcaaagcactgggtgctcttgttgacagctgtgctccaggt
ttgtgccctgactgggagacctgggacccaaagaagcccgtggacaatgcccgggaagcc
atgcagcaggcggatgactggctgggtgtaccacaggttattacccctgaagaaattatc
caccctgatgtggatgagcactctgtgatgacttacctgtcccagttccccaaagccaag
ctgaaaccaggagctcctttaaaacccaaactgaatccaaagaaagcaagggcttatggc
agagggattgagcctcatgggaacatggtgaagcagcctgccatcttcacagtggacacc
atcagtgctgggcagggtgacctgatggtcttcatagaagatccagaaggaaacagagag
gaggcaaagataacgccatccagtgacaaaaacaagacctactcagtacagtatgttcca
agggttactggacctcacaaggtttcagtcctgtttgctgggcagcacatctcaaagagt
ccatttgaagtgaatgttgacaaagcccagggagatgcaagcaaagtgacagcaaaggga
ccaggactggaggcagcagggaacattgccaataaacctacctactttgacctttacaca
gcaggtgctggtgtgggtgacgtgattgtggaagtggaggatcctcagggaagaagcctt
gctgaagttgtagtggaagacaaaggcaaccaagtctaccgttgcacctataaacctgtt
caagctggtcctcacattgtcaaagtgacttttgctggggaggcaattcccaaaactcct
tgcactgttctcattggagaggcctgcaaccccaacgcgtgtcgtgccactggtcgaggc
ctgcagcccaagggcgtccgcatcagggagacggccgacttcaaggttgatacaagagca
gcagggagcggagatcttggagtgattatcaagggaccaaagggcttggaggagttggtg
aaacaaaaaggctttatggatggtatatatgcatttgaatattacccagccacgccaggg
aagtacgttgtcacaattacatggggtgggcaaaacatcccaaaaagtccctttgaagtt
caggtgggtcatgaagcaggtcctcagaaagtgcgagcctgggggccaggactgcacgag
ggagttgtgggcaagtcggctgactttgtggtcgagtccattggcacagaagttggttct
cttggctttgcaatagaaggcccttctcaggctaaaattgagtgtgatgacaagaatgat
ggctcatgtgatgtgaagtattggcccaaggagcctggtgaatatgctgtgcacatcatg
tgtgatgatgaggacataaaagacagcccttacatggcctttattcgaccagcttcagga
gacttcaatgcggataaggtgaaggcttatggcccgggcttggagaggactggctgtata
gtgaacaatcctgccgagttcacagttgaaaccaaggatgctgggaaagcacctctgaag
atgtatgcacaggatggagaaggaaaccctattgatatccagataaagagcaagcctgat
ggtgtatttgcctgctcctatgtgccagttaaaccaatcaaacatacaatttctgttgtc
tggggaggagccaatgtgcccaatagcccatttagggtccttataggtcaagggagtcat
cctcagaaagtcaaagtgtttggacctggcgtggagagaactggcctgaaggcaagtgag
ccaacccacttcactgtggactgcacagatgcaggagaaggtgatgtcagtgtgggaatc
aagtgtgatgctcgtgtggtcagcagtgaggaagaggacatagattttgacatcatccac
aatgctaatgatacattcacagtgaagtactcaccacccgctgccgggcgctacactatt
aaagtgctttttgcaggagaggaaattcctgccagcccattcagagttaaggtggacccc
tcacacgatgccagcaaagtgaaagctgaaggacctgggctgaacaaaactggtgtggaa
aatggcaaaccaacacacttcactgtgttcaccaagggggctggaaaagctccactggat
gtgcagttcagcagctcagtgccaggagaggcagtgatggatctggatatcattgacaac
tatgactattcccacactattaggtacacgcccatacagcagggtccaatgaaggttttg
gtaacttatggcggtgatcctatccctaaaagccctttcacagtgggcgttgctgctcct
ctagacctaagcaaagttatagtcaatggactcgaaaacagagtggaagtagggaaggat
caggaatttgtaattgataccaaaggagctggtgggcaaggtaaactggaggttaatatt
tccagtcctatgagaaaagctgtgccatgtctggtggaaccagttctgggtaaggagtgc
agcactgcaaaatatatcccacgggaagaaggactgtatgtggtggatgtgagttatgat
ggcaacccaatcccagggagcccctacactgtggaggccacactacctccagacccttcc
aaggtaaaagctcatggtccaggtcttcgagggggtcttgttggaaaaccagcccagttt
acaatagataccaaaggggcaggaactggaggtttgggtttgacagtggaaggcccgtgc
gaagctaaaattgaatgttcggacaacggcgatggaacctgctctgtctcctacctgcct
acgaagcctggagagtattttgtaaacatcctctttgaagaagttcacattcctggttcg
ccctttaaggcagatatagaaatgccatttgatgtgtctaaagtcattgccacaggccca
ggtctggagcgtggtaaagtaggcgaggcagggctgctgaatgtcgactgcacggaagca
ggtcctggggacctgcgggtggacatggtgtcagatactggttccaaagctgaggtccag
atcgatgataacaaagatgggacctatgttgttacctacgttccactctcagctggcatg
tacacaatcaagatgagatatggaggagagcaagtgccgaaattcccagcccgggtcaaa
gtggagccagctgtggacacaagcagagttaaagtgtttgggccaggagtcgaaggaaaa
gatgtcttccgagaagctacaactgagttcactgtggatgctcgacctctaacaaaggct
ggtggtgaccacatcaggacacagatcacgagcccatctggctcccccacagactgtctc
atccaagacaacgcggatggaacatattcagtggagtacacgccatttgaaaagggtccg
cactcagtcagcgtgacatacgacggtgtgcctgtgccaaacagtcccttcagagtgaat
gttgcagagggctgccacccatcacgtgtgaaggcacaaggacctggacttacagaagct
ttcacaaatcagcccaatgccttttcagttgtcaccagaggagcaggaattggtggcctt
ggaataactgttgaaggaccttcagaatctaaaattagctgtaaagataacaaggatggg
agctgcagtgccgagtatattccttatgttccaggagattacgatgttaacatcacgtat
gggggagagcatattcctggcagtcctttcaaggttcctgtgaaggatgttgtggatccc
agcaaggtgaagatagcaggaccaggtctgggtacagctgttcgagccaaaatcccccag
tccttcactgtggacaccagcaaagcaggaatagcacctcttgaagtggtggtgacagga
cccagaggagttgtgggacctgttaatgtggtagacaatggagatggcacccacacagtg
gtgtacacccctatgcaggagggaccgtacatgatcactgtcaaatatgctgatgaagag
attcctcgaagtcccttcaaggtgaaggtgcttcctacgtacgatgccagtaaagtgaca
gcgagtggtccagggctcagttcctatggcattctagccagcctgcctgtggagtttgct
gtggatgctaaggatgctgggcagggacttctggctgtacagatcacggaccaagagggc
aaacccaagagagtggacattcatgacaacaaggatggcacttacatggtcacctacgtc
cctgacaaaactggccgctatacgattggcgttaagtatggtggagatgacattccggcc
tccccctacaggatccgggcatctccagctggggatgccagcaagtgtttggccacaggt
cctggaattgcacccactgtgaagactggtgaggaggttggttttgtggtagacgccaaa
tcagcagggaagggaaaagtgacgtgtaccgtcctcacgccagatgggacagaagctgaa
gcagatgttgttgaaaatgaggatgggacttacgatatcttctacactgctgccaaacca
ggaacctatgtgatttatgtccgctttggtggggtggacattcccaacagtcctttcact
gtcatggctgtagatgcagatgacgttgccgcacagtcgcaggagccagtgggcgcttcc
ccgcccggattccgcccttgggttacagaagaagcttacgtccccgttggagacatgaac
ggcatggggttcaggccctttgatatggttatcccatttgctgtaaggaaaggagaaata
acaggtgaagtacacatgccctctggaaagatggatacaccagatatcgtggataataaa
gatggcacagtaacagtgaaatatgctcctactgaggttgggctccatgaaatgcacata
aaatacatgggaaatcacatcccagagagccctctgcagttctatgtcaattaccccaac
agcggtagtgtgtctgcttatgggcctggcctcatttatgggattgctaataaaccagca
actttcaccattgtcacagaagatgcaggagagggtgggctggacttggctattgaagga
ccttcaaaagcagagatcagttgcattgataacaaagatgggacatgcacagtcacgtac
ctccctacactacctgggaactacagcatcctggtaaaatacaatgacaaacacattccg
ggcagtccattcacagccaagatcacagatgataacagaagacggtctcaggttaagctt
ggttctgctgctgacttcatgttggatatcaatgagactgatctcagtctcctaacagcc
agcattaaagccccatctggtcgtgatgagccttgtcttctgaagaggctgcccaataac
cacattggcatctcattcattccacgggaagtaggagaacatctggttagcatcaagaaa
aatgggagccatgtaccaaacagccctgtaacaatcatggtggtccagtctgagatcggg
gatgccagacgggcaagagtttttgggcgtggcttggtagaaggacgaacctttgaaatg
tgtgacttcattgtagacacaagagatgccggttatggtgggatctcactggcagttgaa
ggacccagcaaggtagagatccagactgaagatctagaagatggaacttgcaaagtgtcc
tattttccaactgtacctggtgtgtacattgtgtccactaaatttgcagatgaacatatt
ccaggcagcccatttagtgtgaagataagtggtgaaggaagagttaaggagagcatcaca
cgaacaagacgggctccttctgttgcaacagtaggaagcatatgtgatctgaacctaaaa
atcccggaaattgattgtgctgatatgacagctcaggtaaccagtccctctgggagaaac
tttgatgccgaaattgtagagtgtgacaaaaacacctactgtgtccgctttgtgccacaa
gaaatgggggtccacactgtggatgttaaatacaaagggcagccggtgccaggcagcccc
ttccagttcaccgtgggtccgctgggcgagggaggagcccataaagtgagagctggaggc
ccggggctggagcgtggagagacaggtgttccagctgagttcagcatatggacacgggaa
gctggagctggaggactgtctattgctgtagaaggcccaagtaaagcagaaatcaccttt
gatgaccataaagatggatcttgtggtgcatcatacatagttcaagagccgggcaactat
gaggtgtccataaagttcaatgatgagcacattcctgaaagcccctacctggttcctgtc
atcgccccctccgatgatgctcgcaggctcactgtcactagtcttcaggagtctggatta
aaagttaatcagccagcatcctttgctataaggctgaacggggcaaagggcaagattgat
gctaaagtccacagcccctccggagctgtcgaagagtgccatgtgtctgagctggagcca
gataaatacgccgttcggttcatcccccacgagaacggcatccacaccatcgatgtgaag
ttcaacgggagccacgtggtgggcagccctttcaaagtgcgtgtgggcgagcctggccag
gcgggcaaccctgcccttgtcacagcctacggatccggcctggagagcggcaccacggga
ctgcagtcggagtttttcattaacacgaccaaggctggtccaggtaccctctctgttaca
attgaagggccatcaaaggtgaaaatggactgccaggaaactccagaaggttacaaagtc
atgtacacacccatggctccaggaaactatttaattggagttaaatatggtggacctaac
cacatagtgggcagccctttcaaggcaaaggttacagggcagcgactggttagtccaggc
agtgccaacgaaacctcttccatcctggtagagtcagtgacaaggtcatcgactgaaact
tgctatagcgccattcccaaatccacctcggatgccagcaaagtggtttcccggggagca
ggactctcaaaggcttttgtgggtcagaaaagctccttctctgtggactgcagcaaagca
ggttccaacatgctgttagttggtgtccacggacctacaataccatgcgaagaggtgtcc
atcaagcacttgggcagccatcagtacaatgtcacttatgttgtcaaggagaggggggac
tatgtgctggcagtgaagtggggtgacgagcacattcctgggagtcccttccacgtcacc
gttccatag

DBGET integrated database retrieval system