KEGG   Taeniopygia guttata (zebra finch): 100230758Help
Entry
100230758         CDS       T01082                                 

Gene name
USP18
Definition
ubiquitin specific peptidase 18
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100230758 (USP18)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100230758 (USP18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 335 aa AA seqDB search
MEAEIEVQNTKEETKDVKAKNQKLTSVFGLADLKNEAIGLYNLGQSCCLNSLLQVFLMNI
HFTRILRRITVPSSPAQRRNNVPYQMLLLLEKMQCGKCKAVGPTDLACCLSEHRVELFVQ
HDAAQLFLTLWNLLKKQMKKPELVEELSDLYTICIQEHLACQKCSFEVKNNSTMLTLPLP
VLDANSHRLKTLSMKLVHLPQTLALHLKRFCFERSSRTQKLSLHLPFPQELDLREILTES
QCQADDSEKGTWQFELFAVVAHSGLSSCGHYCAYIRSLTDCKWYCFNDSEVCQVSWDDVK
CTYGHSNLCWRETAYLLFYMKKHPQQPWPGVSECL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagaaattgaagtacaaaatactaaagaggaaaccaaagacgtgaaggccaaa
aaccagaagttgacatcagtctttggtttggcagacttaaaaaatgaagctattggactg
tacaaccttgggcagagctgctgtctgaactctctgctccaagtgttcctcatgaacata
cacttcacaaggatcctccgaaggatcacagtgccctcatctcctgcacagaggaggaac
aacgtcccctaccaaatgctcctgctgttggagaagatgcagtgtggcaagtgcaaagct
gttggtcccacagacctggcttgctgcctttcagagcacagagtggaattgtttgtgcag
catgatgctgctcagctctttctgactctctggaacttgttaaagaagcagatgaaaaag
ccagagctggttgaagagctgagtgatttgtacacgatctgcatacaggagcatctggcc
tgtcagaagtgctcttttgaagtaaagaacaacagcaccatgttaacccttccactccca
gtgctggatgccaattctcacaggctgaagactctgagcatgaagctcgtccatctgcca
cagactctggccttgcacctaaagcgcttctgctttgagagatcctctcgcacgcaaaag
ctgagtctccacctgccattcccacaagaactggatctcagggaaatcttgacagaaagt
cagtgccaagcagatgacagtgaaaagggtacctggcagtttgagctctttgctgtcgtt
gctcattcaggattgagcagctgtggacattactgtgcctacattcggagcctcacagac
tgtaaatggtattgcttcaacgactctgaggtttgccaggtgtcatgggatgatgttaaa
tgcacctatgggcattccaacctctgctggagagaaacagcctatctcttgttttacatg
aaaaagcaccctcagcagccctggccaggagtatcagaatgtctctga

DBGET integrated database retrieval system