KEGG   Taeniopygia guttata (zebra finch): 100230862Help
Entry
100230862         CDS       T01082                                 

Gene name
USP9X
Definition
ubiquitin specific peptidase 9, X-linked
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100230862 (USP9X)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100230862 (USP9X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 2552 aa AA seqDB search
MTATTRGSPVGGNDSQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQADAPPQL
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALNP
HCKFHLYNGTRPSETVPAGVQLAEDELYARPPDPRSPKGWLVDLINKFGTLNGFQVLHDR
FMSGSALNVQIIAALIKPFGQCFEFLTLHTVKKYFLPIIEMVPQFLENLTDDELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDQALSAHIKILDYSC
SQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRH
DLINQLQHNHALVTLVAENLSAYMESMRQYAKEHGEYDPQTVRPGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFF
ENNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
GNDDIANRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSI
NCARQEAIRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHITLVVRFPNQGRQVE
DLDIWSHTNDTIGQVRRCILNRIKANSAHTKVELFIGGELVDPADDRKLIGQLNLKDKTL
ITAKLTQINSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSLHPRYISF
LWQVADLGSSLNMPPLRDGARVLMKLMPPDNTTVEKLRAICLDHAKLGESSLSPSLDSLF
FGPSASQVLYLTEVVYALLMPASAPLGEDASDFQYNFLKSGGLPLVLSMLTRNNFLPNAD
METRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPVVEGTSTISPINQATHDQAVVLQN
ALQNIPNPTSECMLRNVAIRLAQQISDEASKYIPDICVIRAVQKIVWASGCGSVQLVFSS
NEEISKIYEKTNAGNEPDMEDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLL
LHCHSKTVRQMAQEQFFLMATRCCMGQRPLLFFITLLFTVLGSTARERAKHSGDYFTLLR
HLLNYAYNSNINVPNAEVLLNNEIDWLKRIRDEVKRTGETGVEETILEGHLGVTKELLAF
QTPEKKYHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCSSPATINA
GFELLVALAVGCVRNLKQIVDTLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLK
NAGATCYMNSVIQQLYMIPAIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGY
PHQYEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNL
REQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTL
NVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRF
DYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDDVNPENQIIQNEQSENEHSGST
KYRLVGVLVHSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKNQCF
GGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERMDTIDKDNELIKYISEIAITTKPHQI
KMPSAIERSVRKQNVQFMHNRMQYSLEYFQFIKKLLTCNSVYLNPPPGQDHLLPEAEEIT
MISIQLAARFLFTTGFHTKKIVRGPASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRFS
EYLLECPSAEVRGAFAKLIVFIAHFSLQDGPCQSPFASPGPSSQAYDNLSLSDHLLRAVL
NLLRREVSEHGRHLQQYFNLFVMYANLGVAEKTQLLKLNVPATFMLVALDEGPGPPIKYQ
YAELGKLYTVVSQLIRCCNVSSRMQSSINGNPPLANPYGDPNLSQPIMALQQNVADILFV
RTSYVKKIIEDCSNSEETIKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLLL
QILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCPVA
YQILQSNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPIQSNETSNGYFLERSH
SARMTLAKACELCPEEEPDDPDAPDEHESSPPEDAPLYPHSPGSQYQQNNHVHGQPYTGP
AAHHMNNPQRTGQRAQENYEGSEEVSPPQTKD
NT seq 7659 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacgactcgtggctctccagtaggagggaatgatagccagggtcaggctcct
gatggacagtcccagcctcccctccagcagaatcagacttcttcacctgattcttcaaat
gagaactccccagctaccccgcctgacgagcagggccaagctgatgctccaccccagctt
gaagatgaggagcctgcatttccacacacagacctggcaaagttggatgacatgatcaac
aggcctcgatgggttgttcctgtattgccgaagggggaattagaagttcttctagaagct
gctattgacctaagtaaaaaaggccttgatgtcaaaagtgaagcatgccagcgatttttt
cgagatgggctaacaatatccttcacaaaaatccttacagacgaggcggtgagcggctgg
aagtttgagattcatagatgtattattaacaacactcatagactagtggagctctgtgtg
gccaagctgtcccaagattggtttccccttcttgaacttcttgccatggccttaaatcct
cactgcaagttccatctatacaatggtactcgtccctcagaaacagttcctgcaggagtc
cagctcgctgaagatgaactttacgcccgtcctcctgacccacgatcaccaaagggttgg
ctagtagatcttatcaacaagtttggcacattaaatggatttcaggtcttgcatgatcga
ttcatgagtggatcagcattgaatgttcagatcattgcagctctcatcaagccatttgga
caatgttttgaatttttaacattacatacagtgaagaaatacttccttccaattatagaa
atggttccacagtttttagaaaatttaacagatgatgaactgaaaaaagaagcaaagaat
gaagccaaaaatgatgctctgtcaatgataatcaaatctctaaagaacttagcttcaaga
gttccaggacaagaagaaactgtaaaaaatttagaaatatttaggttaaaaatgattctt
aggttgttacaaatttcctctttcaatggtaaaatgaatgcactaaatgaagttaacaaa
gtaatatccagtgtgtcatactacactcatcgacatggtaatcctgaagaggaagagtgg
ctcacagctgaaagaatggcagaatggatccaacagaacaacattttatcaattgtatta
agagatagtcttcatcaacctcaatatgtagaaaaacttgagaaaattctccgatttgtc
atcaaagagaaagctctcactttgcaggatcttgacaacatttgggctgcacaggcagga
aaacatgaagccattgtaaaaaatgtacatgatctcctcgcaaaattagcttgggatttc
tctcctgaacagcttgatcacctgtttgattgttttaaggcaagctggacgaatgcaagc
aagaaacagcgtgaaaaactgctggagttaattcgtcgccttgcagaggatgacaaggat
ggtgtgatggcacacaaagtgctgaaccttttgtggaatttggctcacagtgatgatgtg
ccagttgatatcatggaccaggctcttagtgcccatataaaaatcttagattacagctgt
tcacaggatcgagatacacaaaagatccagtggatagatcgttttatagaagaacttcgc
acaaatgacaaatgggtcattcctgcactgaaacaaattagagaaatttgcagtttgttt
ggtgaagcaccacagaacttgagtcaaactcagcggagtccccatgtgttttaccgacat
gacttaatcaatcaacttcagcacaatcacgccctcgttacactggttgcagaaaacctc
tctgcctatatggaaagcatgaggcagtatgctaaagagcatggtgagtatgatcctcag
actgtgagaccaggaagccgatacagtcacgtgcaggaagtacaggagcgactgaacttc
ttacgatttttattgaaggatggtcagctgtggctctgtgcccctcaggcgaagcaaata
tggaagtgtttagctgaaaatgcggtttatctttgtgatcgcgaagcctgttttaaatgg
tattccaaactaatgggggatgaaccagacttagaccctgacattaataaggacttcttt
gaaaataatgtgcttcagctggatccttccctattaacagaaaatggaatgaaatgtttt
gaacgtttcttcaaagctgtgaactgtcgagaaggaaagctagtagcaaagagacgagcc
tatatgatggatgacctggaattaataggattagactacctttggagggttgtgattcag
ggaaatgatgacattgcaaaccgagcaatagaccttcttaaagagatatatactaatctt
ggcccaaggttacaagttaatcaggtagtgattcatgaagacttcattcagtcctgtttc
gatcgtctgaaagcctcctatgatacattgtgtgtgttggatggagataaagacagtatc
aactgtgcgagacaagaagcaataaggatggtgagagtgttgactgttttaagggagtat
ataaatgaatgtgacagtgattaccacgaagagagaactattctacctatgtcaagagct
ttccgtggtaaacatatcacacttgtagtgcgtttcccaaaccaaggccggcaggtggaa
gatttggatatttggtctcacacaaacgacacgattggccaagtgcggcgttgcatcctc
aatcgcattaaagccaacagtgcacacacaaaagtagagctgttcattgggggtgagctg
gtagatcctgcagatgacagaaaattaattgggcagctgaatctcaaagataaaacgcta
attacagctaagcttacacagataaattctaatatgccctcaagtccagatagttcttct
gattcttcaactggttctccgggcaaccacggcaatcactacagtgatggtccaaatcca
gaagttgaaagctgtttgcctggagtgatcatgtcactgcatcctcgatacatctcgttt
ctttggcaagttgcagacttgggtagtagtctaaatatgccacctcttagagatggagct
cgtgttcttatgaagctcatgccaccagataacactacggtcgagaaactaagagcaatt
tgtttagatcatgcaaagcttggagaaagtagccttagtccatcccttgattctctgttc
tttggtccttctgcctcacaagtgctgtacctaacagaggtggtttatgccttgttaatg
cctgccagtgcacctctgggagaagatgccagtgacttccagtacaacttcctgaaaagt
ggtggtttgcctcttgtgctgagcatgctgaccagaaataacttcctgccaaatgcagat
atggaaactcgaaggggtgcctaccttaatgctctaaaaatagccaaattattgctaaca
gcaattggatatggccatgttcgagctgtggcagaagcttgtcagccagttgtggaaggc
acaagtacaatttcaccgataaaccaggctacgcatgaccaggcagtggtgctacaaaat
gccctacaaaacattcctaatccaacttcagaatgcatgctgagaaatgtagcaatacgt
cttgcacagcaaatatctgatgaggcttcaaaatacatccctgacatctgtgttatcagg
gcagtacaaaaaatcgtttgggcgtcaggttgtggatcagttcagctggttttcagctca
aatgaggaaattagtaaaatctatgaaaagacaaatgcaggaaatgaaccagacatggaa
gatgaacaagtttgctgtgaagcactggaggtgatgaccctgtgctttgctttgattcca
acggcactggatgcactcagtaaagagaaggcgtggcagacatttattattgatttacta
ttgcactgtcacagcaaaaccgttcgtcagatggcacaggagcaattctttttaatggct
accaggtgttgcatgggacagagacctctccttttcttcattaccctgctgtttactgtt
ctagggagcactgcaagagagagagctaagcattctggagactacttcaccctcttaaga
catcttcttaactatgcttacaacagtaatattaatgtacccaatgctgaagttcttctc
aataatgaaattgactggcttaagagaatcagggatgaagtaaaaagaacaggagaaaca
ggtgtcgaagaaacgatcttagagggtcaccttggagtaacaaaagagttgttagcattc
cagacacctgagaagaaataccatattggttgtgaaaaaggaggtgctaatctcattaaa
gagttgatagatgatttcatctttccagcatccaatgtttatctacaatacatgagaaat
ggagaattgcctgctgagcaggccataccagtctgtagttcaccagctactattaatgct
ggctttgagctcctcgttgcacttgcagttggatgtgtgcgaaatctcaaacagatagta
gacacattgactgaaatgtattacataggtacagcaatcactacttgtgaagcgctcaca
gaatgggaatatctgccacctgttgggcctcggccaccaaagggatttgtgggactgaaa
aatgctggtgccacttgttacatgaattctgtcattcagcagctgtacatgattccagcc
atcaggaatgggattcttgcaatagaaggcacaggcagtgatgtagatgatgacatgtct
ggggatgaaaagcaggacaatgagagcaatgttgacccacgagatgatgtctttggttat
ccacatcagtatgaagataaaccagcactgagcaaaactgaagatagaaaagagtacaat
attggagttttgaggcatctccaagtaatttttggccatttagcagcttccaggctacag
tactatgtaccaagagggttttggaaacagttcaggctctggggtgaacctgtaaatcta
cgtgaacagcatgatgctttagaattttttaactcattggtggacagtttagatgaagct
ttaaaagctttgggccatccagcaatgttaagtaaagttttgggagggtcctttgctgat
cagaagatttgtcaaggatgcccgcatcggtacgagtgtgaggaatccttcacaactctg
aatgtagatataaggaatcaccaaaaccttcttgattctttggagcagtacgtcaaagga
gatttattggaaggtgcaaatgcatatcattgtgaaaaatgcaacaaaaaggtggataca
gtgaaacgcttgttgattaagaagttgcctcctgttcttgcgatccagttgaaacgattt
gattatgactgggaaagggaatgtgcaatcaaatttaatgattattttgaatttccacga
gaactggacatggagccttacacagtggcaggtgtagcaaaattggaaggggatgatgtg
aatcctgaaaatcagataatacaaaatgagcagtcggaaaatgaacactctgggagcaca
aaatacagacttgtgggtgtacttgtgcacagtggccaggccagcggtggacattactac
tcttacattatccagaggaatggtggcgatggtgagaagaaccggtggtacaaatttgat
gatggagatgtgacagagtgtaaaatggatgacgatgaagagatgaaaaatcagtgtttt
gggggcgagtacatgggcgaagtgtttgatcacatgatgaagcgaatgtcctacaggcgc
cagaagaggtggtggaatgcttacattcttttttacgaacgcatggacacgatagacaag
gacaatgaactaataaaatatatttcagaaatcgctatcaccactaaaccccaccagatt
aaaatgccctcagccatcgagcgaagcgtgcgcaagcagaacgtgcagttcatgcacaat
cggatgcagtacagcctggaatatttccagttcataaagaagttgcttacttgtaatagt
gtctacctaaaccctcctccaggacaagatcatctgttgcctgaagcagaagaaataact
atgattagtattcagcttgctgctagatttctcttcaccacaggatttcatacaaagaaa
atagtccgtggccctgctagtgattggtatgatgccctgtgcatcctgctccgtcacagc
aagaatgttcgcttttggtttgcacacaacgtcctttttaacgtttcaaaccgcttctct
gaatatctcctggaatgccccagtgcagaagtgaggggtgcatttgcaaaacttatagta
tttattgcacatttttcattgcaagacggaccatgtcaatcaccttttgcctctcctgga
ccttccagtcaggcttatgataacttaagtttaagtgatcacttactgagggcggtactg
aatcttctaagaagggaggtatccgaacatgggcgccacttgcagcagtatttcaatctg
tttgtgatgtatgccaatctaggtgtagcagagaagacacagcttctgaaactaaatgtt
cctgcaaccttcatgctcgtggctttggatgaaggtccaggccctccaattaagtaccag
tatgctgagctggggaagctgtacactgtggtgtcgcagctgatccgctgctgcaacgtc
tcatcgcggatgcagtcttctatcaatggtaatcccccacttgccaacccttatggtgat
cctaatttatctcagcctataatggcacttcagcagaacgtagcagacattctgtttgtg
agaactagttatgtaaagaaaattattgaagactgcagtaattctgaagagaccatcaag
ttgcttcgtttctgctgttgggagaatcctcagttctcttccacagtcctcagtgaacta
ctttggcaggttgcatattcatatacatacgagcttcgaccttatttggatctgcttctg
caaatcctgttaattgaggactcttggcaaactcacaggattcacaatgcacttaaggga
atcccagatgacagggatggactctttgacaccattcagcgctcaaagaatcattaccag
aaaagagcttaccagtgtataaagtgcatggtagctctcttcagcaactgccctgtagct
taccagatccttcagagcaatggagatttgaagagaaaatggacctgggcagtggaatgg
cttggagatgagctggagcgtagaccatacactggcaatccccaatacacctacaataat
tggtctccaccaatacagagcaatgaaacatcaaatggctacttcctagagagatcacac
agtgctagaatgactcttgcaaaggcttgtgaactctgcccagaggaggaaccagatgat
cctgatgccccagatgaacatgagtcttctccacctgaggacgccccactgtatccccat
tcacctggttcccagtatcaacagaataaccacgtgcatggacagccatatacgggcccg
gcagcacatcatatgaacaaccctcagcgaactggccaacgagcacaagaaaactacgaa
ggcagtgaagaagtttccccgcctcagacaaaagattag

DBGET integrated database retrieval system