KEGG   Taeniopygia guttata (zebra finch): 100231115Help
Entry
100231115         CDS       T01082                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 21-like
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100231115
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100231115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 244 aa AA seqDB search
MSLCPPWQCFMNAVLQCLSSTKPLRDYCLRRDFQQEQPPGPRAPQELTEAFADVIAALWH
PDSSEAVNPGRFKAVFQKYVPSFTGYSQQDAQEFLKFFMDRLHVEINRKGRRTPSILSDT
RRPPALEDPETLSDDERANQMWKRYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVF
CDLSLPIPKKSFAGGKVSLHDCFSLFTKEEELDSENAPVCDKCRQRTRSIKKLTIQRFPR
ILVL
NT seq 733 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgtgtcccccctggcagtgcttcatgaacgcggtgctgcagtgcctgagcagc
accaaaccgctgcgggactactgcctgcgccgggacttccagcaggagcagccccccggt
ccccgcgccccccaggagctcaccgaagccttcgccgatgtcatcgccgcgctctggcac
cccgactcctccgaggccgtcaaccccgggcgcttcaaggccgtgttccaaaaatacgtg
ccctccttcacgggctacagccagcaggacgcgcaggaattcctcaagttcttcatggac
cggctgcacgtggagatcaacaggaagggccggcgcacccccagcatcctgtcagacaca
cggagacccccggccctggaggaccccgaaacgctcagcgacgacgaacgcgccaaccag
atgtggaagcgctacctggagagggaggacagcaagatcgtggatctctttgtggggcag
ctgaagagctgcctcaagtgccaggcctgcggctaccgctccaccaccttcgaggtgttc
tgcgacctctcgctgcccatcccaaagaaaagctttgccggggggaaggtctcgctgcac
gactgcttcagcctcttcaccaaggaggaggagctggactcggagaacgccccggtgtgc
gacaagtgccggcagcgcacgcgcagcatcaagaagctgacgatccagcgcttcccacgc
atcctggtgctcc

DBGET integrated database retrieval system