KEGG   Taeniopygia guttata (zebra finch): 100231115Help
Entry
100231115         CDS       T01082                                 

Definition
ubiquitin carboxyl-terminal hydrolase 21-like
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100231115
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100231115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 244 aa AA seqDB search
MSLCPPWQCFMNAVLQCLSSTKPLRDYCLRRDFQQEQPPGPRAPQELTEAFADVIAALWH
PDSSEAVNPGRFKAVFQKYVPSFTGYSQQDAQEFLKFFMDRLHVEINRKGRRTPSILSDT
RRPPALEDPETLSDDERANQMWKRYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVF
CDLSLPIPKKSFAGGKVSLHDCFSLFTKEEELDSENAPVCDKCRQRTRSIKKLTIQRFPR
ILVL
NT seq 733 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgtgtcccccctggcagtgcttcatgaacgcggtgctgcagtgcctgagcagc
accaaaccgctgcgggactactgcctgcgccgggacttccagcaggagcagccccccggt
ccccgcgccccccaggagctcaccgaagccttcgccgatgtcatcgccgcgctctggcac
cccgactcctccgaggccgtcaaccccgggcgcttcaaggccgtgttccaaaaatacgtg
ccctccttcacgggctacagccagcaggacgcgcaggaattcctcaagttcttcatggac
cggctgcacgtggagatcaacaggaagggccggcgcacccccagcatcctgtcagacaca
cggagacccccggccctggaggaccccgaaacgctcagcgacgacgaacgcgccaaccag
atgtggaagcgctacctggagagggaggacagcaagatcgtggatctctttgtggggcag
ctgaagagctgcctcaagtgccaggcctgcggctaccgctccaccaccttcgaggtgttc
tgcgacctctcgctgcccatcccaaagaaaagctttgccggggggaaggtctcgctgcac
gactgcttcagcctcttcaccaaggaggaggagctggactcggagaacgccccggtgtgc
gacaagtgccggcagcgcacgcgcagcatcaagaagctgacgatccagcgcttcccacgc
atcctggtgctcc

DBGET integrated database retrieval system