KEGG   Taeniopygia guttata (zebra finch): 100231238Help
Entry
100231238         CDS       T01082                                 

Gene name
UNC13C
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
tgu  Taeniopygia guttata (zebra finch)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 2208 aa AA seqDB search
MVSALFKSLISSYIYKICKGMFTKKSGNSTKRKESCQSKKEQDLSQIGQTKNPKFSNTLK
STVKRIAKCPSARNLSTEEEESNREFSLSPTFSYRVAIANGLQRHIFVANTNNEDIVQDL
SSNDSSCSESLSEVKTNSKKNEYLSHTMPVRRNRKSLSSLAASDGSSDGERTLHTLKLGA
LRKLRKWKKSQECVSSDSELSSWRKTWGLRSKSLDRTGRHQKSNTLEPGFSSTGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKQSIDEISSSVEVVQNEIEQLRTGFVQSRR
ETRDIHDYIKQIGHPGNKASLRFLNVPEERLEKAESIVYKILMEKMGFSEAQSTIKIEFA
QRLGQQRDCPNAKPRPILVYFESSQQRDLILKKSYKLKGTGIGISTDIFSHEIKDKKERG
LPSSQTYESMDMKLLTVETKSKMHDWESPDSDKDLESDINKNSYAKISRSAFQIKTSTTK
GITESPNTKDLDRTADNSTFSHRSYDNQSPEFDTMEKQSKAYYSDVTPLWNLQNDFATPK
LSRSESDFSKLCQSYSEDFSENQYFSRTNGSSLLSSSDRELWQRRQDDSLNWYGSSQEQT
FAQDMQQYPEQNETGNIETVDSGVSNGIIRVSGDLNHYDDSQLSLQDDLSPWKNWNQLEQ
GADLGLNSSTQEVFVYDMSSPSDQQTDFGKGQSSDLQYDTESYDFTLDGTSPSCPGLDSE
TQSQWTGQYDDYQETNSISSYQNQNKLPMMYRSQSELPSDDSEETAPKSWHSRLSIDLSD
KTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSFMGRFRTLSQSTANESSTTLD
SDVYAEPYCYKAEYEEELIEPSGENETDYVEVMEQVLAKLENRTNSSETSEQIQEYELDQ
SLYETPYAMLPEEQYDTQFDSVISEEILEVESDLAPEVEIKEDENQNVPEMITEVTEIPK
KKRIRPSFKEAALKAYKKQMNDLEEKILAGDSGSVDEKARLVSASSLDASKLYAIPILGG
GGRGLYGIDSMPDLRRKKSFPIVRDVAMTLAARKSGISMAMLMRTSINTDEMKIHVFKKT
LQALIYPISSTTPHNFEIWTATTPTYCYECEGLLWGIARQGMRCTECGVKCHEKCQDLLN
ADCLQRAAEKSSKHGAEDKTQNIISAMKERMKIREKNRPEVFEVIQEMFNISKEDFVQYT
KAAKQSVLDGTSKWSAKVTITVLCAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIFGNLN
PVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIIEVRTLSGEMD
VWYNLEKRTDKSAVSGAIRLKINVEIEGEEKVAPYHVQYTCLHENLFHYLTDVKSNGVVK
IPEVKGDEAWKVYFDDAAQEIVDEFAMRYGIEYIYQAMTHFSCLSSKYMCPGVPAVMSTL
LANINAFYAHTTAATNVSASDRFAATNFGREKFIRLLDQLHNSLRIDLSKYRDNFPASNS
ERLQDLKSTVDLLTSITFFRMKVLELQSPPRASTVVKDCVKACLDSTYKYIFDNCYDLYS
QLVDQSKKQEVPKEEQGPTTKNLDFWAQLITLMVTIIDEDKTAYTPILNQFPQELNMGKI
SAEIMWTLFAQDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELSAFKDAVPEYS
LWFEPFVIQWLDENEDVSMEFLHGALERDKKDGFQQTSDHALFSCSVVDVFTQLNQSFEI
IRKLECPNPEALSHLMRRFAKTINKVLVQYAAIISSYFSSYCDKENVACILMNNIQQLRV
QLEKMFESMGGKELDAEASVVLKELQVKLSNVLDELSVTYAASFQFVIEDCVKQMSNELN
QMRGNGNAAANKNSAAIDAEIVLRPLMDSLDKTLSVSAKICEKTVLKRVLKELWKLVLNK
IEKQIVLPPLTDQTGPQMIFSAAKDLGQLSKLKDHVIREEAKSLTLRQCAIMDVALVTIK
QYFHAGGSGLKKNFLEKSPDLQSLKYALSLYTQTTDTLIKKFISTQTSQSQTANNSVGEI
SVQVDVSTHPGTGEHKVTVKVVAINNLNWQTTAMFRPFVEVCILGPKLSDKKRKHGTKTK
SNTWSPKYNETFQFLLSNEENPGAYEVHLSVKDYCFAREDRVIGMAVIQLQAIADRGGCA
AWHPLLRSISVDETGLTILRILSQRNNDEVAKEFVRLKTETRSAEETT
NT seq 6627 nt NT seq  +upstreamnt  +downstreamnt
atggtttctgctctcttcaagagcctgatctcatcttatatatataagatttgcaaagga
atgtttacaaagaaatcgggaaatagtacaaaaaggaaagagagttgtcagagcaaaaag
gaacaagacttaagtcagattggacaaacaaaaaatccaaaattttccaatactttaaaa
agcaccgttaaaaggattgccaagtgcccatctgctcgcaacttatcaactgaagaagag
gaaagcaatagagaattttcactttctccaacattcagttacagagttgctattgccaat
ggactgcaaaggcatatttttgtagcaaacactaataatgaagatatagttcaagacctg
tcttcaaatgatagctcatgttctgaatcgttaagtgaagtaaaaactaatagcaagaaa
aacgaatacttatcccacacaatgcctgtgcgacgcaacaggaaaagcttgagcagcctg
gcagcctctgatggaagttcagatggagagcgcactttacacacactgaagctgggagcc
ttacgaaaactaaggaaatggaagaagagccaagaatgtgtctcgtcagactcggagcta
agttcatggaggaaaacatggggattaagaagtaaatctctggacagaactggccgtcac
cagaaatcaaatactcttgaacctggctttagttcgacaggttgtattagccaaacccac
gatgttatggaaatgatctttaaagagcttcagggaataagtcaaattgaaacagaactc
tctgaattaagagggcatgttaatgctttgaaacaatcaattgatgaaatttctagtagc
gtagaagttgtacaaaatgaaattgaacaattgcgaactggatttgtacagtccagaaga
gaaactcgggacatacatgactacattaagcagataggccacccaggaaacaaagcaagt
cttaggtttctaaatgtgcctgaagagcggcttgaaaaagctgaaagcatagtttacaaa
atattaatggaaaaaatgggattctcagaggcacaaagcactattaaaattgagtttgcc
caaaggcttgggcagcaaagagactgtccaaatgcaaagccaagacccattcttgtttac
tttgagtcatcacaacagagagatttgattttaaaaaagtcttataaacttaagggaact
ggcattggaatttctacagatatattttcccatgaaataaaagataaaaaagaaagaggg
cttccttcctctcagacatatgaaagcatggatatgaaacttctaacagtggagacaaaa
tctaaaatgcatgactgggagtcacctgacagtgataaagacttggaatcagatataaat
aagaacagttatgcaaaaatatctagatcagcatttcagataaaaacaagcactacaaag
gggattaccgagtccccaaacactaaagaccttgacagaactgctgacaatagcaccttt
tcacacagaagttatgacaatcagtcaccagaatttgacactatggaaaaacaatcaaag
gcctattattcagatgtgactcctttatggaatttacagaatgactttgcaacaccaaag
cttagccgttcagaatcagatttctcaaaattgtgtcagtcttactctgaggatttttca
gaaaaccagtattttagcagaacaaatggcagttcattgttgtcttcctctgatcgagaa
ctttggcagcgaaggcaagatgattctctaaactggtatggcagttcccaggaacagact
tttgcccaagacatgcagcagtatccagagcaaaatgaaacagggaacatagaaactgtt
gatagtggagtaagcaatggaataatccgtgtgtctggagacctaaaccattatgatgat
agtcagctttctttacaggatgatctttccccatggaaaaactggaatcagttggaacaa
ggggcagatttgggcctaaactcatccactcaggaagtttttgtgtatgatatgagcagc
ccttcagatcaacaaacagattttggaaagggccaaagttctgacctccagtatgatact
gaaagctatgatttcactctagatggtacttctccatcttgtccgggccttgacagtgaa
acacaaagtcagtggactggtcaatatgatgattatcaggaaacaaattctatctcctct
tatcagaatcaaaacaaattgcctatgatgtaccgaagtcaaagtgaactaccaagtgac
gactcagaggaaactgcgcctaaatcatggcacagccgattaagcatagatctttctgat
aagactttcagctttcctaaatttggatctacacttcagcgtgctaagtcagctttagaa
gtagtctggaataaaagtacacaaagtttaagtgggtatgaagacagtggatcatctttt
atgggaaggtttagaacattatctcagtctactgcaaatgaatcaagtacaacacttgat
tctgatgtttatgctgagccctattgctacaaagctgagtatgaggaagaattaattgaa
ccatctggtgagaatgaaacggactatgtagaagtaatggaacaagtccttgctaaacta
gaaaatagaactaatagtagtgaaactagtgagcagatccaagagtatgaactggaccag
tcattgtatgaaactccatatgccatgcttccagaggaacagtatgacacacagtttgac
agtgtgatcagtgaagagatattggaagttgaaagtgatttggctcctgaagtagaaata
aaggaagatgaaaatcagaatgtcccagagatgattactgaagttactgaaattccaaag
aaaaaaagaatacgaccatcatttaaagaagctgctttgaaagcatacaagaaacaaatg
aatgatttggaggagaagatccttgctggagatagcggttctgtggatgaaaaggctcgg
ttggtaagtgcaagttccttggatgcttccaagctttatgcaattcctattttgggagga
ggtggtcgtggactgtatggaattgacagcatgccagacctgcgaagaaagaaatctttt
cccattgttcgagatgtggctatgacccttgcagctcgaaaatctggtatttctatggcc
atgctcatgcggacctccataaacactgatgaaatgaaaatacatgtcttcaagaagacc
ctgcaggctttgatctatccaatatcatcaactacacctcataactttgaaatctggaca
gctacaactcccacatactgttatgaatgtgaaggccttctttggggcatagccagacaa
ggcatgagatgcactgaatgtggtgtcaaatgccatgagaagtgccaagatctcctaaat
gctgactgtttgcagagagcagctgagaaaagttccaaacatggtgcagaagacaaaaca
cagaatattattagtgctatgaaggaaagaatgaagattagagagaaaaatagaccagag
gtgtttgaagtgatccaggaaatgtttaatatttctaaagaagattttgtacaatataca
aaagcagcaaaacaaagtgttttggatggaacatccaaatggtcagcaaaagtaactatc
acagttctttgtgctcagggcttacaggctaaggacaaaactggttcaagtgacccatac
gttactgtgcaagttggcaaaaacaagcgaagaacaaaaactatttttggaaatttgaat
ccagtatgggatgaaaaattctattttgaatgtcataactctacagacagaataaaagta
agagtatgggatgaagatgatgatatcaaatctagagtaaagcagcatttcaaaaaggaa
tcagatgacttccttgggcaaacaatcattgaagtaagaacactgagtggagaaatggat
gtatggtataatttagaaaagcgaacagataaatcggctgtctctggggccattagactg
aaaatcaatgttgaaattgaaggagaggagaaagttgctccctatcatgtgcagtacacc
tgtctacatgagaatctcttccattacttgacggatgtgaagtcgaacggtgtggtgaaa
atccctgaggtgaaaggcgatgaggcctggaaggtgtactttgatgatgccgcacaggaa
attgtggatgaatttgcaatgcgctatggaattgaatatatttatcaagctatgacgcac
ttttcctgtctctcttctaaatacatgtgccctggtgttccagcagttatgagtacattg
ttggccaatataaatgctttctatgctcatacaacagcagcaactaatgtatctgcctca
gatcgctttgctgctactaactttgggagagaaaagttcataaggctgctggatcaatta
cacaattccctgaggattgatttatctaaatacagggataattttcctgccagcaattct
gaaagactccaggatctgaaatcaactgtggacctgcttaccagcattactttttttcgg
atgaaggtcctggaattgcagagcccccctcgagctagtactgtggtgaaggactgtgta
aaagcatgcttggattcaacttataaatacatttttgacaattgctatgatctgtactcc
caattagtggatcagagtaagaaacaagaagttcctaaagaagaacagggaccaacaaca
aagaatttggatttctgggcacagctgattactctgatggtcaccataatagatgaagat
aaaacagcatataccccaatcttgaaccagttccctcaagagctgaacatgggaaaaatc
agtgctgaaatcatgtggactctgtttgcccaggacatgaaatatgctctggaagaacat
gaaaagcagcgattatgcaaaagcacagattatatgaatttgcacttcaaagtgaaatgg
ttttataatgaatatgtgcgagaactttctgctttcaaggatgcagtgcctgaatactct
ctgtggtttgaaccatttgtcatacagtggctggatgaaaatgaggatgtgtcaatggaa
tttcttcatggagcactagaaagagacaaaaaagatgggtttcagcaaacatcagatcat
gccctcttctcttgttctgtggttgatgtcttcacacagctcaatcaaagctttgagatt
attaggaaattggagtgtcctaatccagaagcactatctcatttaatgagaagatttgca
aagactatcaacaaagtacttgttcagtatgctgcaattatttcaagttacttcagctcc
tattgtgataaagaaaatgtggcctgtatcttgatgaacaacattcagcaattaagagtc
cagcttgagaaaatgtttgagtccatgggagggaaggagctggatgctgaagctagtgtt
gttctaaaagaacttcaggtgaaacttagcaatgtattggatgaactcagtgtaacgtat
gctgcaagtttccagtttgttattgaagattgtgtaaaacaaatgagcaatgagctgaat
caaatgagaggaaatgggaatgcagcagccaataagaacagtgcagccattgatgctgag
attgtgcttcggcctctcatggattccctggacaaaactttgagtgtctctgcaaaaatc
tgtgagaagacagttctgaaacgggttttgaaagagctctggaagttagtcttaaacaag
atagaaaaacaaattgtgcttccaccactgacagatcaaacggggccccagatgatattc
agtgcagccaaagatcttggacaactgtcaaaactcaaggaccacgtgatccgagaggaa
gccaaaagcctgaccctgcggcagtgtgcaataatggacgtggcactcgttactataaag
caatacttccatgctggaggaagtgggctaaaaaagaatttcctggagaagagtccagac
ctgcagtccctcaaatatgctctcagcctttacacacagactaccgacaccttgataaag
aagtttatatccacacaaacgtctcagagtcaaactgctaataattcagtgggtgagata
tctgtacaggtggatgtctctacccatcctggaactggtgagcataaagtcactgtgaaa
gttgtagcaattaataacctaaactggcaaacaacagctatgttccggccatttgtggag
gtttgcatactgggtcctaagttaagtgacaagaaaagaaaacatggaaccaagacaaag
agcaacacctggtcacctaagtacaatgaaactttccaattcctgctgagtaacgaggag
aatccaggagcctacgaggtgcacctgtcggtgaaggattactgctttgcgcgggaggac
cgcgttatcggcatggccgtcatccagctccaggccatcgccgacaggggcggctgcgcc
gcctggcaccccctgctcaggagcatctccgtggacgagactgggctcacaatccttaga
atactttctcagaggaacaatgatgaagttgctaaagaatttgtaagacttaaaacagaa
acaagatctgctgaagaaacgacctaa

DBGET integrated database retrieval system