KEGG   Taeniopygia guttata (zebra finch): 100231286Help
Entry
100231286         CDS       T01082                                 

Gene name
HEXDC
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100231286 (HEXDC)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100231286 (HEXDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
18
AA seq 467 aa AA seqDB search
MWRRLVHLDLKGAAPRVQYLEQVLPLLRALGATGLLLEYEDTFPYTGPLELLQAPHAYSP
EELRALLSRARAQGLDVVPLVQSFGHMEFVLKHREFAHLREVKALPNALNPHKEESLALV
KAMIDQVMALHEDLKWFHIGCDEVYYLGEGEESKQWLQQQNNTPEKLCLSHIKAVATCLA
WSYPMVTPIVWDDMLRGMSEETLAGSGVPQLVQPMIWDYAADIDVVGKVQLIEKYRRCGF
SKVWFASAFKGATGVNQSLTLIGHHLRNQLEWLQVASRSPADVLEGIALTGWQRYDHFSV
LCELLPVGIPSLAVCLQALKNGGYSEKIKENVENLLGMPNLEIDTFTSPSLGTFPGSNVL
TLVTQISFHLKSSVDELLERNRYVTGWFSPYHRKRKIIHPIVLHHFQPDAVSLFSKWNAV
VQDLQAAMEQVFHRCAIEEWMEENVHPSLQKLQQVLDDLEEAIRAQN
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggcgcctggtgcacctggacctgaagggcgccgcgccgcgagtgcagtacctg
gagcaggtgctgccgctgctccgtgccctgggtgccaccgggctgctgctggaatatgag
gacaccttcccatacacggggccgctggagctgctgcaggccccccacgcctacagcccc
gaggagctgcgggcgctgctgagccgggcgcgggcgcagggcctggacgtggtgccgctg
gtgcagagctttgggcacatggagtttgtgctgaagcacagggagtttgcccatctgcgg
gaggtgaaggcgctgcccaacgccctgaacccgcacaaggaggagtcactggcactggtc
aaagccatgattgaccaggtcatggccctgcacgaggacttgaagtggtttcacatcgga
tgtgatgaggtctactaccttggtgaaggagaggagtcaaagcagtggctgcagcagcaa
aacaacactccagagaagctgtgcttatcccacataaaagcagttgccacttgtttggcc
tggtcttaccccatggtgacacccatcgtgtgggacgacatgctcagggggatgagtgag
gaaacactggcaggttccggggtcccacagctggtgcagcccatgatctgggactatgca
gcagacatcgacgtggtgggcaaagtgcagctcatagagaagtaccgcaggtgtggcttc
tccaaggtgtggtttgcaagtgccttcaagggagccacgggggtgaatcagtctctgaca
ctgatcgggcaccacctcaggaaccagctggagtggctgcaggtggccagcaggagccct
gctgatgtcctcgaaggtatcgcgctgaccggctggcagaggtatgatcacttctctgtt
ttgtgtgagcttctccctgtgggaattccatccctggccgtgtgtctgcaggcactaaag
aatggtggctattctgaaaagattaaagaaaatgtggaaaatctcctgggaatgcctaac
ctggaaattgatactttcacaagcccaagtctggggacctttcctgggagcaatgtcctc
acccttgtgacacaaattagtttccacctcaagtcatcagtggatgaacttctggaaagg
aacaggtatgtcacaggctggttcagcccctaccacaggaaaaggaagattattcatcct
attgtactgcaccacttccagccagatgcagtcagtctcttctccaagtggaatgctgtg
gtgcaagacctgcaagcagccatggagcaagttttccacaggtgtgctatagaggaatgg
atggaggagaatgtccaccccagcctacagaagctgcagcaggtgctggatgatttagag
gaagcaataagagcacaaaattag

DBGET integrated database retrieval system