KEGG   Taeniopygia guttata (zebra finch): 100231397Help
Entry
100231397         CDS       T01082                                 

Definition
uncharacterized LOC100231397
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100231397
Messenger RNA biogenesis [BR:tgu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100231397
   mRNA cycle factors
    P-body specific factors
     100231397
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 849 aa AA seqDB search
MKVTFQTPQRDPHTRKILSPAMADKLQTTFALDDCREDVADDVLFSPSDADTCQQKTEAE
TNNIQMPEKVSVAPYPDDEMPVKSRGSYNLDFDNLNDINPFQSSVQLPHSPGNLQKSPVK
VSSTPEKTIEKSNDSLLRDDAAPFVSTTASTECLSEDKALISEKESALSELESNKSKLSP
KQAVGDSEQGVKSASTDASQTDNSVVLAEAPTPPVQSPGSLGPSSSDVRNSFKTEESKLQ
NVSVAERACAQESKPDEELGVSKGKPAEKPDVTKAGPVKLEFDFGNTTARKPPPKKLGKR
PGIKTPSKKIPITKTKPENTEVQNKSNVEDEIPIPKASYKFDWDKLDDPNFNPFGGGSKI
STSPKRSKPSPQKVHLPEEQESTSPRREPLPVEQDNRPSTSETLEKEEPKNLEIVGQSVV
EDMPKAQEEKPGVQAEAELPAKREVEKQMSPSKMPPANVAPSQDNLVSTDSGKESMSAEE
IKPSSPRIEVTADETANAKPEELFRPSSEVFGMGIDYLEQFGSSSFKESALRKQSLYLKF
DPLLRDSPRKPVYGTIESRENIVTAPSQPGPVADLSNVPEEAGKPLVTLESEEKPKGLDL
LGTHATSDAGPLIPDSLSSNIPPVPFATSTNTAVDAIIDVLKYSQKDMDAAVELVKKEVQ
EKELEIEEWNKKYNKLHMEYKEMGKIVAEFEQTITQIMEDAQKQKEASRKEIQKLTEEKQ
QAVSDLNSMEKSFSELFKRLEKQKDALEGYHKNEEVLKKCAEDYLARIKKEEQRYQALKA
HAEEKLQQANEEIAQVRSKAKSEIAALQATLRKEQMRIQSLERSLEQKTKENDELTKICD
DLILKMEKN
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaacctttcaaactcctcaaagagatcctcacactagaaaaatcctgagtcct
gctatggcagacaaacttcagactacttttgcacttgacgattgccgtgaagatgtggcg
gatgatgttttattttcaccctctgatgctgacacatgtcaacaaaagactgaagctgaa
acaaacaatatacaaatgccagagaaggtcagcgtggctccttacccagatgatgagatg
ccagtgaagagtcgaggttcctacaatcttgattttgataacttaaatgatatcaatcct
tttcaaagttcagtacagttgcctcattctcctggaaatctgcaaaagtctcctgtaaaa
gtatccagcacccctgagaaaactattgaaaaaagtaatgattctcttctgcgggatgat
gcagctccttttgtttcaaccacagcaagtacagagtgtttaagtgaagacaaggctctc
atttctgaaaaagaatctgcgctgagcgagctggagtctaacaaatccaagctgtcccct
aagcaagcagttggtgactctgagcagggtgtgaagtctgcttccacagatgcaagccaa
actgataattcagtggtattagcagaggcacctacacctcctgtacagtcacctggcagc
ttaggtcccagtagttctgatgtaagaaactcttttaaaactgaggaatcaaagcttcag
aatgtttcagtagcagaacgagcctgtgcacaagagtcaaagcctgatgaagagctgggt
gtctccaaagggaagcctgcagaaaagcctgatgtcaccaaggctggaccagtaaaactg
gaatttgactttggtaataccactgctagaaaaccacctcctaagaaactaggtaaaaga
cctggaattaagacaccttccaaaaaaattcctattaccaaaacaaaaccagagaatact
gaagtgcaaaataaaagtaatgtggaggatgaaatccctattcctaaagcatcttataag
tttgactgggacaaacttgatgatccgaactttaatccatttggaggaggctctaaaatt
tccacctcacccaagcgttctaaacccagccctcagaaagttcacctgccagaggaacag
gagagtacctcgccaagaagggaacctcttccagtggagcaggataacagaccaagtacc
agtgaaactcttgagaaggaagaacccaaaaatctggaaattgttgggcagagtgtggta
gaagacatgccaaaagctcaagaagagaagccaggagttcaagcagaagctgaacttcca
gcaaaaagagaagtggagaagcaaatgagcccatctaaaatgcctccagctaatgttgcc
cctagtcaagataatttggtttccactgacagtggaaaagagtcaatgtctgcagaagaa
attaaacctagttcccctagaattgaagtaacagcagatgagacagctaatgctaaacct
gaagagttattcagaccgtcatcagaagtttttggaatgggcatagactatctggaacag
tttgggtcttcatcattcaaagaatcagccttgagaaaacagtcactgtatttgaagttt
gaccctctgttgagagacagtccaagaaaaccagtttatggtactattgaatcaagagag
aacattgtgacagctccatctcagcctggtcctgttgctgatttaagtaatgttcctgag
gaagctggaaagcctctggtgactcttgagagtgaagaaaaaccaaaaggactagatctg
ctggggacacatgcaacttctgatgctggtcccctaattccagactccctgagtagtaat
attcccccagtcccttttgctacttctacaaacactgcagtggatgctattatagatgtg
ctaaaatatagccaaaaagacatggatgcagctgttgaactggtgaagaaagaggttcaa
gagaaagagctggagattgaggaatggaataagaagtataataagcttcatatggaatac
aaagaaatgggaaaaatagttgctgaatttgaacagacaataacacaaattatggaggat
gctcagaagcagaaggaagcctcaaggaaagaaatacagaagctgacagaagagaagcag
caagctgtttcagatctgaactctatggagaagtccttctctgagctcttcaaacgactt
gaaaaacagaaagatgccttagagggttaccacaaaaatgaagaagttctgaagaaatgt
gcagaagattacttggctagaattaaaaaagaggagcagagataccaggcactcaaagca
catgctgaggaaaagctgcagcaagccaatgaggaaattgctcaggttcgcagcaaagcg
aaatcagagattgcagcgcttcaagccactctgcgcaaagagcagatgaggatccagtct
ttagagaggagccttgaacaaaagactaaagaaaatgatgaattaacaaaaatctgtgat
gacttgatcttgaagatggaaaaaaattga

DBGET integrated database retrieval system