KEGG   Taeniopygia guttata (zebra finch): 100231484Help
Entry
100231484         CDS       T01082                                 

Gene name
USP30
Definition
ubiquitin carboxyl-terminal hydrolase 30-like
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
15
AA seq 726 aa AA seqDB search
MVWLSRAQFGLAWHGSDQFTHGWAWLGSAQCGLARLRSPGLSSAQLGSAERGSAGPGLAA
APPWDRLRRANAPSPGAAEGTAGRVPEGHIQRHREPPGTAAGQRCPGWTTFPGVFALSIP
TGAPRERPRGRNVPLLSRSSAPHGCGTRPSRRGCEGGTAREVRCVTSGPACEARGCAPHR
CHTGNGPVIPSHREGARYPVTPGTAPLPRHTGHSPVTPPPVPPPVSAITAAPLPAPPLPG
PGSARPCWRPGRHRAMRSWGVLGGAAAALAAGIYVLWGPISGRKRRRRGLVPGLLNLGNT
CFMNSLLQGLSSCPSFIRWLEEFTAQYRTEQEKAPEHQQHLSVTLLQLLRALSCQEVTED
DVLDASCLLEVLRMNRWQISSFEEQDAHELFHVLTSSLEDERDRQPRVTHLFDVQSLEQP
EIIQKQISCRTRGSLPPMSNHWKTQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIP
AAVWGRPMTLDHCLHHFISSESVKDVVCDNCTKIQAEGILNGQSIENQRTTFVKQLKLGK
LPQCLCIHLQRLSWSNQGTPLKRHEHVQFNEFLVMDIYKYRVPGPKSCQEQLSQKNSEET
TPGMKDGRAGKPSDAEQPAGTKPLFMNGASSSSSSSPSFLMSPGTFPLTAFPECRAPLYL
YRLMAVVVHHGDMHSGHFVTFRRAPGARGSQWLWISDESVRRASLHEVLAASAYLLFYER
GYQGGG
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggtttggctcagccgggctcagttcggtttagcttggcacggctcggatcagttcacc
catggctgggcctggcttggttcagctcagtgtggtttagcacggctgcgctcacccggg
ctcagctcagcacagctcggctcggctgagcgcggctcagcagggcccggcttagccgcg
gctcccccatgggatcggctgcgccgggcgaacgccccgagcccgggcgctgctgagggc
accgcgggccgtgtccccgagggtcacatccagcggcaccgggaacccccgggcaccgca
gccgggcagcgctgcccgggctggacaacctttccaggagtgttcgccctcagtatccca
actggagcgccccgtgagcgaccacggggccgcaacgtcccgctgctctcccggagctct
gcgccacacggctgcgggacgcgtccctcacggcggggctgtgagggcgggacagcgcgg
gaggttcggtgcgtcacatcaggaccggcctgtgaggcgcggggctgcgcgccacaccgg
tgtcacaccgggaacgggccggttatcccgtcacaccgtgaaggggcccgttaccccgtc
acaccgggcacagccccgttaccccgtcacaccgggcacagccccgttaccccgcccccg
gtgccgcccccggtctccgccataaccgccgcgccacttccggccccgccgctgcccggc
cccggctccgcccggccatgctggcggccgggccggcaccgagccatgcggagctggggg
gtgctggggggcgcggcggcggcgctggcggccggcatttacgtcctgtggggccccatc
agcggcaggaagcggcggcggagagggctggtgccaggcctcctgaacctgggcaacacg
tgtttcatgaattccctgctccagggcttgtcctcctgcccctcgttcatcaggtggctg
gaggagttcacagcccagtacaggacagagcaggagaaggccccggagcaccagcagcac
ctctccgtgactctgctgcagctcctcagagctttgtcctgccaggaggtgacagaggac
gatgtcctggatgccagctgcctgctggaggtgctgaggatgaacaggtggcagatctcc
tcctttgaggagcaggatgcccatgagctgttccatgtcctgacctcttccctggaggac
gaacgggatcggcagccccgtgtgacccatttgtttgatgtgcaatccctggagcaacca
gaaataatccaaaagcaaataagctgcaggacaagaggatctcttccccctatgtccaac
cactggaaaactcagcaccctttccatggaaggctgaccagcaacatggtctgcaaacac
tgtgagcaccagagccctgtgaggtttgacaccttcgacagcctctccctgagcattcca
gcagctgtgtggggtcgtcccatgacactggatcattgcctccatcacttcatctcctca
gagtctgtgaaggatgttgtgtgtgacaactgcaccaaaatccaggcagaaggaattctg
aatggacagagcatagaaaaccagagaacaacgtttgttaagcaattaaagctaggaaag
ctgccccagtgtttgtgcatccacctgcaaaggctgagctggtccaaccaagggactccc
ttgaagagacacgagcacgtccagttcaacgaattcctggtcatggacatctacaaatat
cgggttcctggtcccaaatcctgccaggagcagctcagccagaaaaactctgaggagaca
acccctggaatgaaggatgggagagcagggaaaccttcagatgcagaacaaccagctggt
accaaacctctcttcatgaatggtgcctcctcttcctcctcctcctctccctcatttttg
atgtccccaggaactttcccacttactgcattccctgagtgtagggccccgctgtacctg
taccgcctgatggccgtggtggtgcaccacggggacatgcactcgggacacttcgtcacc
ttccggcgcgcgccgggcgcccgcggcagccagtggctctggatctcggacgagtcggtg
cgcagggccagcctgcacgaggtgctggctgccagcgcctacctgctgttctacgagcgt
ggctatcaaggtgggggttga

DBGET integrated database retrieval system