KEGG   Taeniopygia guttata (zebra finch): 100231681Help
Entry
100231681         CDS       T01082                                 

Definition
(RefSeq) cGMP-dependent protein kinase 1
  KO
K07376  
cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Vascular smooth muscle contraction
Gap junction
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100231681
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    100231681
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100231681
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100231681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
6
AA seq 283 aa AA seqDB search
MKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWT
ILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKK
IGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYN
IILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLR
KGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctgaagaagcggcacatcgtggacacacggcagcaggagcacatccgctcc
gagaagcagatcatgcagggcgcccactccgacttcatcgtcaggctctacaggacgttc
aaggacagcaagtacctgtacatgctgatggaagcctgcctggggggagagctctggaca
attctcagggacaggggttcattcgaggattccaccaccaggttttacacggcgtgcgta
gtggaagcctttgcctacttgcattccaaagggatcatttatagggacctcaagccagag
aacctcattctggatcaccgaggttatgccaagctggtcgattttggctttgcaaagaaa
ataggatttggaaagaaaacatggactttttgtggcaccccggagtacgtagcccccgag
atcatcctgaacaaaggtcacgacatttcggcagactactggtccctgggaatcctgatg
tatgagctcctgactggcagtccccctttctcaggcccagaccccatgaagacctataac
atcatattaaggggaatagacatgattgaatttccaaagaagattgccaaaaatgctgct
aacttaattaaaaaactatgcagggacaatccatcagaaagattagggaacttgaaaaat
ggagtgaaagatatccaaaagcacaaatggtttgaaggctttaactgggaagggttacgg
aaagggacactgacgcctcccatcatcccaagtgtcgcgtctcccacggacacaagcaac
ttcgacagcttcccagaggacagtgacgagccaccccctgacgacaactcaggatgggac
atagatttttaa

DBGET integrated database retrieval system