KEGG   Taeniopygia guttata (zebra finch): 100231681Help
Entry
100231681         CDS       T01082                                 

Definition
cGMP-dependent protein kinase 1-like
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Gap junction
Class
Cellular Processes; Cell communication; Gap junction [PATH:tgu04540]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 432 aa AA seqDB search
THYENGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGED
VRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSD
FNIIDTLGVGGFGRVELVQLKSEEAKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSD
FIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKG
IIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISA
DYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNP
SERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEP
PPDDNSGWDIDF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
actcactacgagaatggagagtacatcatccgccaaggggctcgaggggacaccttcttt
atcatcagcaaaggaaaggtgaacgtcacccgggaggactctccaagtgaagatcccgtc
tttctccgcactctgggcaagggggattggtttggagaaaaagctctccaaggggaggat
gtcaggacagccaacgtcatcgcagctgaagcggtcacttgtctggtcatagacagagac
tccttcaagcacctgatcgggggcctggacgacgtctccaacaaagcctatgaggatgca
gaagcaaaagcaaaatacgaagccgaagctgccttctttgccaacctgaaactgtcggat
ttcaacatcatcgacaccctgggagtcggaggcttcgggagagtggagctggtgcagctg
aagagcgaggaggccaagacgttcgccatgaagatcctgaagaagcggcacatcgtggac
acgcggcagcaggagcacatccgctccgagaagcagatcatgcagggcgcccactccgac
ttcatcgtcaggctctacaggacgttcaaggacagcaagtacctgtacatgctgatggaa
gcctgcctggggggagagctctggacaattctcagggacaggggttcattcgaggattcc
accaccaggttttacacggcgtgcgtagtggaagcctttgcctacttgcattccaaaggg
atcatttatagggacctcaagccagagaacctcattctggatcaccgaggttatgccaag
ctggtcgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgt
ggcaccccggagtacgtagcccccgagatcatcctgaacaaaggtcacgacatttcggca
gactactggtccctgggaatcctgatgtatgagctcctgactggcagtccccctttctca
ggcccagaccccatgaagacctataacatcatattaaggggaatagacatgattgaattt
ccaaagaagattgccaaaaatgctgctaacttaattaaaaaactatgcagggacaatcca
tcagaaagattagggaacttgaaaaatggagtgaaagatatccaaaagcacaaatggttt
gaaggctttaactgggaagggttacggaaagggacactgacgcctcccatcatcccaagt
gtcgcgtctcccacggacacaagcaacttcgacagcttcccagaggacagtgacgagcca
ccccctgacgacaactcaggatgggacatagatttttaa

DBGET integrated database retrieval system