KEGG   Taeniopygia guttata (zebra finch): 100231681Help
Entry
100231681         CDS       T01082                                 

Definition
cGMP-dependent protein kinase 1-like
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Gap junction
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100231681
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100231681
Protein kinases [BR:tgu01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100231681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 432 aa AA seqDB search
THYENGEYIIRQGARGDTFFIISKGKVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGED
VRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSD
FNIIDTLGVGGFGRVELVQLKSEEAKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSD
FIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKG
IIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISA
DYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNP
SERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEP
PPDDNSGWDIDF
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
actcactacgagaatggagagtacatcatccgccaaggggctcgaggggacaccttcttt
atcatcagcaaaggaaaggtgaacgtcacccgggaggactctccaagtgaagatcccgtc
tttctccgcactctgggcaagggggattggtttggagaaaaagctctccaaggggaggat
gtcaggacagccaacgtcatcgcagctgaagcggtcacttgtctggtcatagacagagac
tccttcaagcacctgatcgggggcctggacgacgtctccaacaaagcctatgaggatgca
gaagcaaaagcaaaatacgaagccgaagctgccttctttgccaacctgaaactgtcggat
ttcaacatcatcgacaccctgggagtcggaggcttcgggagagtggagctggtgcagctg
aagagcgaggaggccaagacgttcgccatgaagatcctgaagaagcggcacatcgtggac
acgcggcagcaggagcacatccgctccgagaagcagatcatgcagggcgcccactccgac
ttcatcgtcaggctctacaggacgttcaaggacagcaagtacctgtacatgctgatggaa
gcctgcctggggggagagctctggacaattctcagggacaggggttcattcgaggattcc
accaccaggttttacacggcgtgcgtagtggaagcctttgcctacttgcattccaaaggg
atcatttatagggacctcaagccagagaacctcattctggatcaccgaggttatgccaag
ctggtcgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgt
ggcaccccggagtacgtagcccccgagatcatcctgaacaaaggtcacgacatttcggca
gactactggtccctgggaatcctgatgtatgagctcctgactggcagtccccctttctca
ggcccagaccccatgaagacctataacatcatattaaggggaatagacatgattgaattt
ccaaagaagattgccaaaaatgctgctaacttaattaaaaaactatgcagggacaatcca
tcagaaagattagggaacttgaaaaatggagtgaaagatatccaaaagcacaaatggttt
gaaggctttaactgggaagggttacggaaagggacactgacgcctcccatcatcccaagt
gtcgcgtctcccacggacacaagcaacttcgacagcttcccagaggacagtgacgagcca
ccccctgacgacaactcaggatgggacatagatttttaa

DBGET integrated database retrieval system