KEGG   Taeniopygia guttata (zebra finch): 100231833Help
Entry
100231833         CDS       T01082                                 

Gene name
USP10
Definition
ubiquitin specific peptidase 10
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 792 aa AA seqDB search
MGLVTEHEGKYIFGEFSPDEFNQFFVTPRCSVELPPYNETVSCGIKSTGEEYQRIEFGVN
EVIETQSSVLNNTDYSISSTLNPQAPEFILSCAPAQKTPDDALSDTNYNSIDCQFSDPTL
ALDSGSNAENDALAGGLGQRERKKKKKRPPGYYSYLEDVPDGVAAPEALVNGHASAAGLS
SLSAEDAELAGDLPSLATPRTCSSPASSVDFLAGAACAEPGPGAAAPGRTAGQPEVCRLA
HSEQFCLPSEAVRESPLRTAVVQAYAGTDTTETLGVTNGQTLESSGEDTAANGVELHTVE
STDSDQAKPEEASPTTEATVPLAGSVPVNQPAKSWASLFHNSKPSASTSVVYVETKYTPP
ATSPLVPEKQVEVKEGPVPVSEDPVAIKIAEILENVRLIHKPVSLQPRGLINKGNWCYIN
ATLQALVACPPMYHLMKSIPMYSKSQRPCTSTPMLDSFVRLMNEFTNMPVPPKAKQALGD
KIVRDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFILNGLHEEMLTLKKLLS
PHNEKVSVSNGPEAQSVPKEEEQEEQGEGSEDEWEQVGPRNKSSVTRQADFVQTPITDIF
GGHIRSVVYQQSSKESATLQLFFTLQLDIQSDKIRTVQDALESLVARESVQGYTTKTKQE
VEISRRLTLEKLPPVLVLHLKRFVYEKTGGCQKLIKNIEYTVDLEISKELLSPGVKSKIS
KGQRTYRLFAVVYHHGNSATGGHYTTDVFQIGLNGWLRIDDQAVRVIHHSQVVKAALERT
AYLLYYRQVDLL
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgggtttggtgacagaacacgaggggaagtatatttttggggagttcagccctgatgaa
tttaatcagttctttgtgactccacgatgctctgttgagctccccccatacaatgaaaca
gtttcatgtggtattaaatccacaggggaagagtatcagagaattgaatttggtgttaat
gaagttattgagactcagtcatctgtcctaaataacaccgactacagtatttcgagtact
ctgaatcctcaggctccagaattcattctcagctgtgcacctgctcagaaaacccccgat
gatgctctcagcgacacaaactacaactccattgactgccagttcagtgaccccaccctg
gctctggacagcggctccaacgccgaaaacgacgccttggctgggggccttgggcagagg
gagcggaagaagaagaaaaaaagaccccctggatactacagctacttggaagatgtccct
gacggcgtggccgccccggaggcgctggtgaacggccacgcctcggccgcgggactcagc
agcctgagcgcggaggacgcggagctggcaggagacctcccctcgctggccacgccgagg
acttgcagcagccccgccagctccgtggacttcctggccggagctgcgtgtgccgagccc
ggccccggcgccgcagcccccggcaggactgcggggcagcccgaggtatgccgccttgct
cattctgaacagttctgcctcccctcggaggccgtcagagagagccccctaaggacagct
gttgtacaggcttatgctggtactgatactactgaaactcttggcgttactaatggacaa
acacttgaatcctctggtgaggacacagctgccaatggggtagaattgcacactgtggaa
agcactgactcagaccaagctaagcctgaggaagcttcacctactactgaggcaacggtc
ccgcttgcaggatcggtccctgttaatcagcctgcaaaatcgtgggctagcctttttcac
aattccaagccctctgcctccacatctgtggtctatgttgagactaagtatacccctcct
gccacatctcctctggtccctgaaaaacaggttgaagtcaaagagggacctgttccagtt
tcagaggatcccgtagccataaagattgcagaaatactggaaaatgtaagactaatacat
aaaccagtgtctttgcaaccccgagggctgatcaacaaaggaaactggtgctacatcaat
gctaccctgcaagccttggttgcttgccctccaatgtatcatttaatgaagtccattcca
atgtattccaaatcgcagaggccgtgcacctccacaccaatgctagacagttttgttcgt
ttaatgaacgagttcactaatatgcctgtacctcctaaagcaaagcaagctttaggtgat
aaaatagtgagagacatccgaccaggagctgcctttgaaccaacctacatttacaggctc
ttgacggttataaagtcaagtctgtcagaaaagggcaggcaagaggatgctgaagaatac
ttgggatttatcctcaatggactacatgaagaaatgctgaccctcaagaaacttctatct
ccacataatgaaaaagtgtcagtgtccaacggccccgaggctcagagtgttcccaaggaa
gaggagcaggaggagcagggggaaggcagcgaggacgagtgggagcaggtgggaccccgc
aacaaatcctcggtcactcgccaggctgactttgtccagactccaatcactgatattttt
ggtggtcacataagatctgttgtttaccagcagagttccaaggaatctgccacgctgcag
cttttcttcaccctgcagctggacatccagtcggacaagatccgcaccgtgcaggatgcc
ttggaaagcttggtggcaagagagtctgtgcagggctacaccacaaaaaccaagcaagag
gtggagatcagtcgaagactcaccttagaaaagctgccccccgttcttgttctacacctc
aaacgcttcgtgtatgagaagactggtggatgccagaagctgatcaagaacattgagtac
actgttgatctggaaatcagcaaagagctactatctcctggtgtgaaaagtaaaatttca
aaaggccaaagaacctaccggctctttgcagttgtgtaccaccacggcaacagcgccacg
ggcgggcactacaccacggacgtgttccagatcggcctgaacgggtggctgcgcatcgac
gaccaggcggtcagggtcatccaccactcgcaggtggtgaaggcggccctggagcgcaca
gcctacctcctgtactaccgccaggtggacctgctgtga

DBGET integrated database retrieval system