KEGG   Taeniopygia guttata (zebra finch): 100231871Help
Entry
100231871         CDS       T01082                                 

Gene name
KAT6A
Definition
(RefSeq) K(lysine) acetyltransferase 6A
  KO
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100231871 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
22
AA seq 2007 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDGKPNVDWNKLIKRAIEGLAESGGSSLKN
IERFLKGQKDVSALFGGSAASIFHQQLRLAVKRAVGHGRLLKDGPLYQLNTKATTNADGK
ESFESLSCLPPVCLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHP
SCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTR
MPKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKNQNTTSKGPFSKVRTG
PGRGRKRKMALSSQSASSEGGYLEQTDVLDFCRDGSNTLKFNKKTKGLIDGLTKFFTPSP
DGRKARGEVVDYSQQYRIRKKGTRKSSTSEWPTDNQDGWDGKQETEERFFGSQDVLNEKD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIQTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQRDKQLSIKKLSKLTG
ICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQEHMAKLRTNVRPVDVDAECLRWTPVIV
SNSVVSEDEEEETEDGENEEQQKQKEKDPETSMVKSVSWEKKEQEPYSPTESEKKPDIVA
PANSARPNRHIFSLDSLPANSQPSRRGRWKRKSKKIHEPFCEKEPALPIEEKTAVPSGRC
SECEEKSAASRGRCSDCEKSVALQGRCGECEEKSPASRGRYAEDDEKSAASQGQYGKGEK
SAIPRRQHSEAVERWRGQLKKNTEPLKCRFPEDCDRLPRRYSDSDRALLRCFSESSEEED
DEPVSPRSSSPPVLTKPTLKRKKPILHRKRRVRKRKHHNSSVVTETISETTEVLDEPFED
SDSERPMPQLEPTFEIEEEEEEEEEDEEEESELSSSGYFQHLAQPDTLRHRPSSKRKSRD
EEESDDNGNRPLKPLSMLRNSEAKGSSLEPDTSTPMKKKKGWPKGKSRKPVHWKKRPGRK
PGFKLNREEVPLSVQDEIVDEVVANSKPGRKAKISDKEECVEQKDLPLTEERKEEDVNLE
AEEVGEGEEEDIASSEVRAVSPVDSNSSPVPEVKEPEIEEEVEEKPQILEEQRQSEEEQQ
ELDEPEHDHEEEEELAVVTNQNEDHDADDEDDGHPESLKKKELEEQPIKEGVKEEPQVQE
CFLETSIPSSREDAKEKDEAEADSEEEQASNETSVGSEHVPGSEDDHEEEQSNKEGLIEL
KEEEEIPHSELDLETVQAVQSLTQEESNEHDVAYQDCEETLAACQTLQSYTQTEEDPQIS
MVEDCQASEHNSPISSVQSHPSQSVRSVSSPNVPALESSYTQISPEQGSLSAPSMQNMET
SPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNNSSQSSCSY
GGLSSSSSLTQNSCVVTQQMANIGSSCSMMQQNNVQPTANCNIKSPQSCVVERPPSNQQP
TTQPQQQQPQSQQPQPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIP
GDFGAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAP
SHPLAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHIS
IRSKSAPLPSATAHQQQLYGRSPPTVAMQAGPRTLAVQRGMNMGVNLMPTTPYNVNSMNM
NLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMM
YTGPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 6024 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgccaacccgctgtatacagagtggattttggaggcaatcaaaaaggta
aagaagcaaaaacagcgaccttcagaggagaggatatgcaacgctgtgtcatcttcacat
ggtttggaccgcaaaactgttctggaacagttagagttgagtgttaaagatggaactatt
ttaaaagtctccaacaagggtctcaactcctacaaggatcctgataatcctgggagaata
gcacttccgaagcctcggaatcatggcaagttggatggtaaaccaaatgtggactggaat
aaacttattaaacgggcaattgagggcttggctgagtctggtggctcatccttgaagaac
atcgagcgctttctgaaaggtcagaaagatgtgtctgcattatttggaggtagcgctgcc
tccatttttcaccagcaattacgattagctgtcaaacgtgctgtcggccatggtaggctc
cttaaggatgggcctctgtaccaactcaacactaaagcaaccactaatgctgatgggaag
gagagttttgagtctctttcctgtctccctccagtgtgtctccttccccatgaaaaggat
aagccggttgccgaaccaattccaatttgcagtttctgccttggtacaaaagagcaaaat
cgggagaagaaacctgaagagctcatctcttgtgctgactgtggcaacagtggtcatccg
tcctgtttgaagttctctccagagctgacagttcgagtgaaagccttgcgatggcagtgt
attgaatgcaaaacatgcagttcctgtagagatcaaggaaaaaatgctgataacatgcta
ttttgtgactcatgtgaccgtggctttcacatggaatgctgtgatcctcctcttaccagg
atgccaaaaggtatgtggatatgtcaaatatgtcgaccacgtaagaaaggaagaaaactt
ctacagaagaaggcagcacagataaaaagacgctatgctaacccaataggacgtcctaaa
aacaggttaaagaatcaaaacacaacatcaaaaggtcctttcagcaaagttcgcactggt
cctggtcggggtaggaagcgtaagatggctctgtccagccagtcagcatcatcagaagga
ggatacctggaacagacagatgtcttggacttctgcagagatggcagcaacaccttgaaa
tttaacaagaaaaccaaagggcttatagatggccttactaaattcttcactccctcccct
gatggacgaaaagctcgaggagaagtggtagactattctcagcagtataggatcaggaaa
aagggtaccaggaaatctagcacttcagaatggcccacagacaatcaggatggctgggat
ggaaaacaagaaactgaggagcgtttttttggaagccaggatgtcttaaatgaaaaagac
atggagttgtttcgagatattcaggagcaagcactgcagaaagtaggggtgactgggcct
cctgatccacaagtccgctgcccttctgttatagaatttggcaaatacgaaatccagacc
tggtactcctccccatatccacaggaatactcaaggctgccgaagttgtacctttgtgaa
ttctgtctaaaatacatgaaaagcagaactattctccaacagcatatgaaaaaatgtggg
tggtttcatcctccagcaaatgaaatttacagaaaaaataatatatcagtctttgaggtt
gatggcaatgtcagcactatctactgccagaatttgtgcttgttagctaaactcttcttg
gatcacaagactctctattatgatgtggagccatttcttttctatgtcctgacgcagaat
gatgttaagggctgtcaccttgttggctacttttccaaggaaaaacactgccaacagaag
tacaatgtttcctgtataatgattcttccacaataccagcgtaagggctatggcaggttc
ctaattgacttcagctatttgctttcaaagcgtgagggtcaagcaggatcaccagaaaag
cccctgtcggacctcgggcgcctgtcatatatggcttattggaaaagtgtaatattggag
tgcctttatcatcaacgtgacaagcaattaagcatcaagaaattgagtaagctgactgga
atctgccctcaagatatcacttccactctgcaccacctacgaatgcttgacttccgtagt
gatcaatttgtgatcattcgtcgggagaagcttatccaggaacacatggcaaagcttaga
actaatgtccgacctgttgatgtggatgcagaatgtctgcgttggacacctgttatagtt
tccaactcagttgtctctgaagatgaagaagaggaaacagaggatggggaaaatgaagag
caacaaaagcagaaagaaaaggatccagagaccagtatggtaaaatctgtgtcatgggag
aagaaagagcaagagccttactcaccaacagagagtgaaaaaaagccagacattgttgct
ccagccaattctgcacgaccaaacaggcacattttttccctggatagtcttcctgcaaac
agtcagccgtcacgaagaggtcgatggaagcgcaagagcaaaaaaattcatgagcccttc
tgtgagaaggagccagcattgcccatcgaggaaaaaacagcagttcccagtggacgatgc
agtgaatgtgaggaaaagtcagcagcctcacgaggccggtgcagtgactgtgagaagtca
gtggccttgcaaggaagatgcggtgaatgtgaggagaaatctccagcctcgagaggccgg
tatgctgaagatgacgaaaaatctgcagcttcccagggacagtatggcaaaggtgaaaaa
tctgcaattccccgtcggcagcacagtgaagctgtggaaaggtggagggggcagttgaaa
aagaacacagagccactgaaatgtagattcccagaggactgcgacagattaccccggcgc
tacagtgatagtgatagggcacttctgaggtgttttagtgagagcagtgaagaggaagat
gatgagcctgtgagtcctcgatcaagctctccacctgttctcaccaagccaacattgaaa
cgaaagaaaccaattcttcatcggaagaggcgggtccgcaagcgtaagcaccacaacagc
agtgttgtcactgaaacaatctcggaaaccacagaagtgctggatgaaccatttgaggac
tcagactctgaacgaccaatgcctcaattagagcctacatttgagattgaggaagaggaa
gaggaggaggaggaggatgaagaggaggagagtgaactttcatccagtggatactttcag
cacttagcccaaccagacacactcaggcatagaccctcttctaagaggaagtccagagat
gaagaggagtctgatgacaatggtaaccgacccttgaaaccattatctatgctgaggaat
agtgaagcaaagggttcttcactcgagccagatacttccacacctatgaaaaagaagaag
gggtggccaaaagggaaaagccgaaaaccagtccactggaagaaaagacctggtcgaaaa
ccaggttttaaactgaaccgagaagaggtgccactatcagttcaggatgaaatagttgat
gaagtggtagctaattcaaaaccagggcgtaaagccaaaatttcagataaagaagaatgt
gttgagcagaaggacctgcctctcactgaggaaaggaaagaggaagatgtgaatctggaa
gcagaagaggtaggagagggagaagaggaagatatagccagcagtgaagtaagagcagtt
tctcctgtggacagcaacagcagtccagtgccagaagtaaaagaacctgagatagaagag
gaagtagaggagaagccacagattttagaagagcagaggcaatcagaagaagagcagcaa
gaattagatgaacctgaacatgaccatgaggaagaagaggaacttgcagtagtgacaaat
caaaacgaagatcatgatgctgatgatgaagatgatggtcatccagagtctttgaagaaa
aaagaattggaggaacagcccattaaagaaggggtgaaggaggagcctcaggtgcaagaa
tgttttttagaaacaagcataccaagcagtagagaagatgcaaaagaaaaagatgaagca
gaggcagattctgaggaagagcaggcttccaatgagacatcagtgggctcagagcatgtc
cctgggtctgaagatgatcacgaagaagagcaaagtaataaagaggggttaattgaatta
aaggaagaggaggagattcctcatagtgaactagatcttgaaactgttcaagcagttcag
tccttgacacaggaggaaagcaatgagcatgacgtagcttaccaggactgtgaagaaact
cttgcagcttgtcagaccttgcagagttatacccagactgaggaggatcctcagatatca
atggttgaagattgtcaggcctcagaacacaacagtccaatatcctctgttcagtcccac
cccagccagtctgtgcgttctgtgagcagcccaaatgtgcctgctctggagagcagttac
acacagataagtcctgagcaaggatccctgtccgcaccctctatgcagaacatggagacc
agccccatgatggatgtgccttcagtatcggaccactctcagcaggtggtggatagtggc
ttcagtgaccttggcagcattgagagcactacagagaattatgaaaaccccagcagctat
gactccactatgggaggaagcatttgtggaaataactcttcccagagcagctgttcatat
ggaggactgtcttcttctagcagcctcactcagaacagttgtgttgtcactcagcaaatg
gcaaacattggcagcagttgcagcatgatgcagcaaaacaatgtccagcctacagcaaac
tgtaatatcaagtcacctcagagctgtgtagtagaaaggcccccaagtaaccagcaacca
acaacacagccacaacagcagcagcctcagtcccagcagccacaacccccacctccaccc
cagcagcaacctccattatctcagtgtagcatgaacaacagcttcaccccagcacctatg
atcatggaaatacctgaatcaggcagcactggtaacataagtatctatgagaggattcca
ggggattttggtgctgggagctattcacaaccatcagccacattcagtttagcaaagttg
cagcagctgacaaacaccattatggaccctcatgccatgccttatagccattctcctgct
gtgacttcctatgcaaccagcgtttctctttccaacacagggctggctcagctggctcct
tctcaccctctggctggcaccccacaagcacaagccactatgacacccccaccaaacctg
gcatccaccaccatgaacctcacatcccctctgcttcagtgtaatatgtctgctaccaat
attggtattccccatactcagaggctgcaggggcagatgccagtcaaggggcacatttcc
atccgctccaaatcagcccccctgccctcagcaactgcacaccagcagcagctgtacggc
cgcagcccccccaccgtggccatgcaggctggacctcggaccttggctgtgcagcggggc
atgaacatgggagtcaacctgatgccaaccaccccgtacaacgtgaactccatgaatatg
aacttgaatgccatgaacagctacagaatgacacagcccatgatgaacagcagttaccac
agtaatcctgcctacatgaatcagacagcacagtatcctatgcagatgcagatgggaatg
atggggagccaggcctatacccagcagcctatgcagccaaatcctcatggaaacatgatg
tacactggcccctcccatcacagctacatgaatgctgctggggtgcccaagcagtctctt
aatggaccatacatgagaagatga

DBGET integrated database retrieval system