KEGG   Taeniopygia guttata (zebra finch): 100231894Help
Entry
100231894         CDS       T01082                                 

Gene name
GLS
Definition
(RefSeq) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100231894 (GLS)
   00220 Arginine biosynthesis
    100231894 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100231894 (GLS)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100231894 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 491 aa AA seqDB search
MDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESA
KKQSGGKVADYIPQLAKFSPDLWGVSLCTVDGQRHSVGDTKVPFCLQSCVKPLKYAIAVN
DLGTEYVHRYVGKEPSGLRFNKLFLNEDDRPHNPMVNAGAIVITSLIKQGANNAEKFDYV
MQFMNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVAILDFYFQLC
SIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGL
PAKSGVAGGILLVVPNVMGLMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAK
KLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSGMDMEQRDYDSRTALHVAAAEGH
VDVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPSEDNNDGKEN
RTVHKNLDGLL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggatatgctaagactgactcttcagactacttcagatggtgttatgctggacaaagac
ctttttaaaaagtgtgtacagagtaatattgtgttgcttactcaagctttcagaaggaag
tttgtcattccagattttatgtcatttacttcccatattgatgagctatatgaaagtgct
aaaaaacaatctggaggaaaggttgctgactatataccacaactggccaagttcagccct
gatttgtggggggtgtcactttgcaccgtggatggacagaggcattctgtgggtgatacc
aaagttccattttgtctccagtcctgcgtaaagcctttgaaatatgcgattgctgtcaat
gatcttggcacggagtacgtgcacagatatgttggtaaagagcctagtggattaagattc
aacaaattgttcctgaatgaagatgacaggcctcataaccctatggtgaatgctggagca
attgtgatcacatctttaatcaagcaaggagcaaataatgcagaaaaatttgactacgtg
atgcagttcatgaataaaatggctggtaatgagtatgttggattcagtaatgctacgttc
cagtctgaaagagagagtggagatagaaactttgcaattggctattacttaaaagagaaa
aagtgctttcctgaaggcacggatatggttgctatactagacttctattttcagctttgc
tcaatagaagtaacatgtgaatcagcaagtgtgatggcagcaactctggctaatggtggc
ttttgcccaatcactggtgagagagtcctgagccccgaggcagtccggaataccttgagt
ttgatgcattcctgtggcatgtatgacttttcagggcagtttgccttccatgttggtctt
cctgcaaaatctggagttgctggtggaattcttctggttgttcctaatgtcatgggcttg
atgtgctggtcacctcctttggacaagatgggcaacagtgttaaaggaattcacttttgt
catgatctggtttctttgtgcaatttccataactacgataatttgagacactttgcaaaa
aagcttgatcctcgcagagaaggtggtgatcagcgggtgaagtctgtgataaatctgctg
tttgctgcctacacaggggacgtgtctgcactccggaggtttgctctgtcaggaatggat
atggagcagagagactatgactcacggacagccctgcatgtggcagctgcagaaggacat
gtggatgttgttaagtttctgctggaagcgtgcaaagtgaatcctttccccaaagacagg
tggaataacactcctatggatgaagctttacattttggacaccatgatgtttttaaaatt
cttcaagaatatcaggtccaatacacaccatcagaggataacaacgatgggaaggagaac
cgaacggttcataaaaatctggatggcttgctataa

DBGET integrated database retrieval system