KEGG   Taeniopygia guttata (zebra finch): 100231913Help
Entry
100231913         CDS       T01082                                 

Gene name
GALM
Definition
galactose mutarotase (aldose 1-epimerase)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100231913 (GALM)
   00052 Galactose metabolism
    100231913 (GALM)
Enzymes [BR:tgu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100231913 (GALM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 382 aa AA seqDB search
MGQRGTRIQALRSAPSGAAGVSRLRGPRQRESASWPSAPSEKLVLAQVADGARCPAVGAS
SALGVLAAGWWKSCRGGKKKKIVVTKDRDGQFSDVVLGFDTLEGYTRKHPFFGAVVGRVA
NRIANGRFSLDGKEYQLFLNNGPNSLHGGAKGFDKVLWSAQVLPNGVRFFRLSPDGEEGY
PGDLKVWVTYILSGRELAINYQAQSSKTTPISLTNHTYFNLAGQGSRDVYDHEISIEADS
YLPVDDTQIPTGEVAAVQGTGFDLRQPVELGKHLQKFHLDGFDHNFCLHQGQDRRLVARV
FHPPSGRIMEVHTTQPGIQFYTGNNLDGSLKGKGAATYPRHSAFCLETQNWPDAVNKPHF
PNVLLHPGEEYNHSTWLVFSTA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcgcgggacgcggatccaggcgctgcggtccgccccgagcggcgcggccggc
gtgtcccggctgcgagggccacggcagcgggagtcagcgagctggccctcggccccgagc
gagaagctggtgctggctcaggtggccgatggggcgcgatgtccggcggtgggagccagc
agcgcccttggcgtgctcgctgcgggctggtggaaatcctgtcgggggggaaaaaaaaaa
aaaattgttgttactaaagacagggatgggcagttttctgatgttgtcctaggatttgac
actttagaaggttacacgaggaagcacccgttcttcggtgctgtcgtgggccgtgttgcc
aacaggattgcaaacgggaggttcagcctggacgggaaggagtatcagctgttcctcaat
aatgggcccaacagcctgcatggaggagccaagggatttgacaaggttctctggagcgcc
caggtgctcccaaatggtgtccgcttcttccggctcagccccgatggcgaggaaggctac
cctggtgacctgaaggtctgggtgacctacatccttagtggcagggagctggccatcaac
taccaggcccagagcagcaagacgacccccatcagcctgacaaaccacacgtacttcaac
ctggcggggcagggctcccgggatgtctatgaccacgagatctccattgaagcagattcc
tacctgcctgtggacgacacccagatccctactggggaggtggccgctgtgcagggcact
ggctttgatctccggcagcctgtggagctgggcaagcacttgcagaagtttcacctggat
ggctttgaccacaacttctgcctgcatcaggggcaggatcgacgccttgtggccagggtt
ttccacccgccctctggcaggatcatggaggttcacaccacccagcctggcatccagttt
tacactgggaacaacttggatggctccctgaagggcaaaggtgctgccacgtaccccagg
cactcggctttctgcctggaaacccagaactggcccgatgccgttaacaagcctcacttc
cccaatgtcctgctccatccgggtgaggaatacaaccacagcacatggctcgtgttcagc
actgcttga

DBGET integrated database retrieval system