KEGG   Taeniopygia guttata (zebra finch): 100232055Help
Entry
100232055         CDS       T01082                                 

Gene name
USP28
Definition
ubiquitin specific peptidase 28
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
24
AA seq 1028 aa AA seqDB search
MKEITGIQDSAFLLAALKAADGDLMEAVTFLTEDPAPEPVQSPAAAELSAWEGSTVGKQL
PQDVGTAAAPHNQDNLRTANTVRPLESPKAPAAESDAAERPQDAHSAENKNRSKRKRCEA
WGENSKQNDWRRAGDWPVGMKNIGNTCWFSAVIQSLFQLPEFRRLVLGYSLPQNVLESCR
SHTGKRNIAFMQELQCLFALMLGTWRKFVDPSAALELLRDVFRSSEQPQQDVSEFTHKLL
DWLEDAFQLTVNVTSLGDKSENPMVQLFYGTFLTEGVHKGNTFSKIETFGQYPLQVNGYR
NLNECLEGAMVEGEMDETPASQSVKYGQERWFTKLPPVLTFELSRFEFNQSLGQPEKIHT
KLEFPQTIYMDRYLYCNKDLIQMKREEMKRLKEKMVTLQQKLERYMEYGSGPARFPLPDM
LQYVLEFIATKPAVAVSSAQSSQAPLLRSQAKPNVLDLLSQPNGIQERTDTRTEDEAFFV
ANSSPQQSSSMELQPPVSPAELSERPAPHVVSKEELNLVQTCLQRWRNEIEQDVQDLKES
IARINLSIEQMYCDPLLQQVPYRLHAVLVHEGQANAGHYWAFIYDQPRKRWLKYNDISVT
ESSWEELERESFGGLRNASAYCLMYISDQVSPVGADEDESPEARQFQKEVEALSPELRHY
IQEDNWRLEQEAEEWDEEQSCKIPQMEPSPTSELQDLSSESGPEQSSVCEQSVHSLSSEH
ARIAKEQTAKAIANTADAYEKNGVEAALCEAFHEEYSRLYLLSKETPTPQNDARLQHVLI
YFLQNNAPQQVVERTLLEQFADKNLSYDERSISIMKVARAKLSEIGPDDVDMEEYKRWHE
DYSLFRKVSIYLLTGLELYQNRKYQESLTYLVYAYQSNTKLLLKGANRGVSESLIALYRR
KCLLKLNEVAASLFVSCEEAHVSEGVSILNELIIPCMHLMSNLAVSQEDLDAIEVMRNRW
CSYLGREDMDAKLQMKLGELLPRLLDGSTEVIMLKEPPKIRPNSPYDLCSRFAAVMESIH
GASAVTVN
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatcacaggaattcaggattcagcattcctgcttgctgctctaaaggctgct
gatggagatctcatggaagcagtcaccttcctgacggaggaccctgctccggagcctgtg
cagagcccagctgctgcagagctgtctgcctgggaagggagcacagtgggcaaacagctc
ccacaggatgttggtactgcagctgcccctcacaaccaagacaacctccgcacagccaac
actgtcagaccactggaatcaccaaaagctccagctgcagaaagtgatgcagctgaaaga
ccacaggacgcccattctgctgaaaacaaaaaccgctccaaaaggaaacgctgtgaagcc
tggggagagaactccaagcagaatgactggagaagagcgggtgactggcctgttggaatg
aaaaatataggaaatacatgttggtttagtgctgttatacagtctctgtttcagttgcca
gaattccggaggctggtccttgggtattccctcccacagaatgtacttgaaagttgtcgt
agtcacactggaaaaagaaatattgcattcatgcaagaacttcagtgtctgtttgcatta
atgctggggacatggcgtaagtttgtagacccttcagcagcactggagctcttgagggac
gtgtttagatcatctgaacaaccgcagcaagatgtgagtgaatttacgcacaaactactg
gactggctggaggacgcattccagctcactgtgaatgtcacgagccttggggacaaatct
gaaaacccaatggtgcagctcttctacgggactttcctgactgagggagtccataagggc
aacactttttccaagattgagacctttggtcagtatccccttcaggtaaatggttaccgg
aacttgaatgagtgcttggaaggagccatggtggagggagagatggatgagacaccagca
tctcagtcagtgaagtatggacaggagcgctggtttacaaaactcccaccagttctgacc
tttgaactctcccgatttgagttcaatcagtcactaggacagccagagaaaattcacacc
aagctagagtttccccagactatatatatggacaggtacctatactgcaataaagacctt
attcagatgaaaagagaggaaatgaagagattgaaggagaaaatggtgactctgcagcag
aaactggaaaggtacatggaatatggctctggcccagcccgctttccactgcctgacatg
ctgcagtatgtgctggagttcattgctacaaagccagctgtggctgtttcctctgctcag
agctctcaagcgccactcctgcgctcccaagccaagcctaatgttctggacttgctttca
cagccaaacggcatacaagaaaggactgatacgaggactgaagatgaagctttctttgtg
gcaaattcttcaccacagcaaagctccagtatggagctccagcctcctgtttcaccagca
gaactgtctgaacgtccagctcctcacgtggtctccaaagaagagctgaacctggttcag
acgtgtctgcagcgatggagaaacgagatcgagcaagatgtgcaagatctgaaggagtct
attgccagaatcaacctatccattgaacaaatgtactgtgaccctctcctccagcaggtt
ccctatcgtttgcatgcagtcctggtccatgaggggcaagcaaatgctgggcactactgg
gccttcatatatgaccagcctcggaaaagatggctcaagtacaatgacatctcagtgacg
gagtcctcgtgggaagagctggagagagagtcctttggaggcctgaggaacgccagtgcc
tactgcctgatgtacatcagtgaccaggtgtcccctgttggtgcagatgaggatgagagc
ccagaggctagacagttccagaaagaagtggaagctttgtccccagaactgagacactac
atccaggaggacaactggcgcctggagcaggaggcagaggagtgggacgaggagcaatct
tgcaagattcctcaaatggagccttcacctacttctgaattgcaggacctctcctctgag
tcgggaccagagcagtcatcagtgtgtgagcagagcgtgcactccctgtcctcggagcat
gccaggattgccaaggagcagactgccaaggccattgccaacactgccgatgcctacgag
aagaacggtgtcgaggcagctctgtgcgaggcattccatgaggagtactcccggctgtac
ctgctttccaaagagaccccaaccccccagaacgatgcccggctgcagcacgtgctcatc
tacttcctgcagaacaacgctccgcagcaggtggtggaacggaccctcctcgagcagttt
gcagacaaaaacctcagctatgatgagcggtccatcagcatcatgaaggtggcacgggca
aagctgagcgaaattggtcctgacgatgttgacatggaggagtacaagagatggcacgaa
gactacagcctttttcgcaaggtgtccatctacctgctgacggggttggaactctaccag
aatagaaagtaccaagagtcactcacctacctggtctatgcctaccaaagcaacaccaaa
ctgctgctgaagggagccaaccgaggcgtgagcgagtcgctgatcgccttgtacagaagg
aaatgtctcctgaagctgaacgaggtggcagcttctctttttgtcagctgtgaagaagct
catgtgtcagagggtgtgagcatcctgaatgagctgatcatcccctgcatgcatctcatg
agcaacctggcggtctcccaagaggacctggatgccatcgaggtgatgagaaaccgctgg
tgctcctatttgggacgagaagacatggacgcaaagctgcagatgaagctgggtgagctg
ctgccccggctcctggacggctccaccgaggtcattatgctgaaggagcccccgaagatc
cggcccaactccccttacgacctgtgcagccgctttgcggccgtgatggagtccatccac
ggggcctccgccgtgacggtgaactag

DBGET integrated database retrieval system