KEGG   Taeniopygia guttata (zebra finch): 100232057Help
Entry
100232057         CDS       T01082                                 

Gene name
NUP205
Definition
(RefSeq) nucleoporin 205kDa
  KO
K14310  
nuclear pore complex protein Nup205
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100232057 (NUP205)
Messenger RNA biogenesis [BR:tgu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100232057 (NUP205)
Chromosome [BR:tgu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100232057 (NUP205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 1990 aa AA seqDB search
MNAIWKRQPEAVHRLDQVLKKHKSDFISLFRNPPKNVQQHEKIQKASTEGVAIQGQQGTR
LLPEQLIREAFILSDLFDIGELAAVELLLAGEHQQPHFPGLTRGLVAVLLYWDGKRCIAN
SLRTLIQSRQGKTWTLELSQELISMTTRFTDDLMEQGLTQKILTLVSQIDLNNEFDKLQR
ERGLGSEKHRKEVSDLIKECRQSLAESLFVWTCQSPLSKDDTLILISYLEKVTVEADGSL
DGVNLSLLMALLYCFDVSFLEQGAEDREDLMHRLPLLAERQYIATIHTRLQESQPWKLPG
LQATVRLAWALTLRGISQFSDVTALAEFTEADEAMAELAIADYVFLFLTESVVASENFYQ
EEFYIRKIHNLVTDFLALMPMKVKQLRNRADEDARMIHMSIQMGNDPPISLRRDLEHLML
LIAELYRKDPFNLELAHEYWCPSEPLQTSTIMGSYLGVAHQRPPQRQVVLSKFVRQMGDL
LPSTIYIPYLKMLRGLASGPQCAHYCFSLLKVNGSSHAENIQGAGGSPVSWEHFFHSLML
YHEHLRKDLPSADSVQYRHLPLRGITQKEQDGLIAFLQLTTVIVTWSENARLALCEHPQW
TPVVVILGLLQCSIPPILKAELLETLTAFGRSPEIAASLWQSLEYTQILQTVRSPGQRQA
IGIEVELNEIESRCEEYPLTRAFCRLISTLVESSFPANLGAGLRPPGFDPYLQFLRDSVF
LRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQLEDFVDQYVELQGEEIIAYKPPGFN
LMYHLLNESPMLELCLSLLEEGVKQLDTYAPFPGKKHLEKAVQYCLALLNLTLQKENIFM
DLLRESHLSLIVTPLEQLLQGINPRTKKADHVVNIARYLYHGNSNPELAFESAKILCCIS
DNSNIQIKLVGDFTHDQSVSQKLMAGFVECLDNEDAEELINPDEELEPEKKRAQIHHETR
IHILNLLITSLECSPPSLALYLLGFELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKGT
ETRSGPTAVRESPHLAELCYQVIYQLCACSDTSGPTMRYLRTSQDFLFTQLQYLPFSIKE
HEISTLNQMSWLMKTAAIEMRVTSLNRQRSHTQRLLHLLLDDMPVKPYLADGEGGMEDES
RSVSGFLHFDSASKVRRKILNILDSIDFSQDIPEPLQLDFFDRAQIEQVITNCEHKNARG
QVVCNVKYVHRVLVAEVNALQGMAAIGQRPLLMEEINTILQYVVERNKLLQCLHAKRHAL
ESWRQLVEIILTACPQDLIQAEDRQLIIRDLLQDVHDKILDDDAAQELMPVVAGAVFTLT
AHLSQSVKTEQKQPLALSMAGQSQYVLMLDGSFTSSPGSESISMGFASVGDSSLHIILKK
LLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDTLEAAKKTMWEHLTAPEDMFSKL
QRENMATIESYGAALMEVVCRDACDGHEIGRMLALALLDHIVSVDKQQQWLLYLSNSGYL
KVLVDSLADDDLALQSLLTPQPPLLKALYTYESKMAFLTRVAKSQQGALELLRSGVIVRL
AQCQVYDMRPETDHQGMYAMRDPPVFIPTPVERYRQILLPALQLCQVILTSSMAQHLQAA
GQVLQFLISHSDTIQAILRCQDVSVGSLQELASLTGIISKAALPGVLNELDVDVNEGTQM
ELQGHIGRFQRQCLGLLSRFGGSDRLRQFKLQDDNVAGDRVNKRDEIELAMQQICANVME
YCESLMLQSAPSFQHTVCLFTPSLSESTNRDGPRQDTQTPVVPYWHLPGLGIIVYLLKQS
TSDFFSYYDSHRQNVNKLQNVEQLPPDEIKELCQSVMPAGVDKISTSQKYVLARRRLVKL
INNRAKLLSLCSYVIEICLFILWRHLEHYLLHCTPTDSQDPLLSSRMSFKKGRLQDSFGS
EPSLDFSSGLNRVSQHDIEQLQIEATNSFGESLQKKLLDIEGLYSKIRSRYTFIQALIRR
IRGLLRISRT
NT seq 5973 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccatttggaaaaggcaacctgaagctgttcatcgtctcgatcaagttttaaag
aagcacaaatctgacttcatttctctcttcagaaatccgccaaaaaatgttcagcagcat
gagaaaattcagaaagcaagcacagaaggagttgctatccagggtcagcagggaactagg
cttttgccagagcagctcatcagagaagcctttatcctcagtgacctcttcgatattgga
gagttggcagctgttgagctccttctagctggagaacaccaacagcctcactttcctggg
cttacaagaggtctagtggcggttctgttgtactgggatggaaaaagatgcattgccaat
tcactgcgaaccctcatccagtcacgccaaggcaagacgtggacattggaactcagtcag
gagttaatttccatgacaacacgctttacagatgacctaatggagcagggtttgactcag
aagatccttacacttgtgtctcagattgatttgaacaatgaatttgataaacttcagaga
gagcgaggattgggcagtgagaaacatcgaaaagaggtttctgatctcattaaagaatgc
cgacagtccttggctgaaagtctctttgtctggacctgtcagtcacccctgagtaaggat
gacactctaatcctcataagttacctggagaaggtaacagtggaagccgatggctcattg
gatggcgtgaacttgtctcttctcatggctctcctttactgttttgatgtcagctttctg
gaacaaggggcagaggatcgtgaagacttgatgcaccggctccctctgctagcagaaaga
cagtacatagcaacgatccacactcggcttcaggagtctcagccctggaaattaccaggc
ctgcaagctactgttagattagcctgggcactgacattgcgaggcatatcccaattttct
gatgtgacagctctagcagaattcactgaggcagacgaagcaatggcggagctagcgatt
gctgattatgttttcctgttcctgactgaatctgttgtggcgtctgaaaatttctaccag
gaggaattttacattcgcaaaatccataaccttgtcacggacttccttgcactcatgcca
atgaaagtgaaacagctgagaaaccgtgctgatgaagatgctcgcatgatccacatgagt
attcagatgggtaacgatccacctatttcccttcggagagatctggagcatttaatgctt
ctcatcgctgagttgtataggaaagacccctttaatctggaacttgcccatgagtactgg
tgtccgtcggagcccctgcagacatccaccatcatgggctcctatcttggagtagctcac
cagcgaccccctcagcgccaggttgtcttgtcaaagtttgttaggcaaatgggagatcta
cttccttccacaatttacatcccatacttgaaaatgctgcggggactggctagtgggcct
cagtgtgctcattactgctttagtttgctaaaagtcaatggcagtagtcatgcggaaaac
atccaaggagcaggtggcagtcctgtctcctgggagcatttcttccactctttgatgctt
tatcatgagcacttaaggaaagacttgccaagtgcagacagtgtccagtaccgtcacctg
cctctccgaggcatcacacagaaagaacaggatggattaattgcatttttacagctgact
actgttatagtcacttggagtgagaatgctcgcttggctctttgtgagcaccctcagtgg
acaccagtagtggtcatcctgggacttctgcagtgcagcattcctcctattttgaaagca
gagctattagaaacccttactgcttttggaagatctcctgaaatagctgcttcactctgg
caatccctggaatatacacagatattacaaactgtgagaagtccaggccagagacaagca
attggtattgaggttgaattgaatgagattgagtcccgatgtgaggaatatcctttaact
cgtgccttctgtcgactcatcagcactctggtggagagttcattcccagctaacctgggt
gcaggtctccgccctccaggctttgatccctatctccagttcctcagggattctgtgttt
ctccgattccgcacacgagcttatcggagagctgctgaaaaatgggaagtagctgaggtt
gtcctggaagtgttttacaaattattgcgggactacgaaccacaacttgaagactttgtg
gaccaatatgtggagttacaaggagaagaaataatagcatataagccacctggattcaat
ttgatgtatcatctgttgaatgagtccccaatgctggaactttgccttagtttgctagaa
gaaggggttaagcagcttgatacttacgctccatttcctgggaagaagcatttagagaaa
gctgtacagtattgccttgcacttctaaacctaaccctacagaaggagaatatttttatg
gatctgttgcgggagagccatctgtcccttattgtcacaccactggagcagctgcttcaa
ggaatcaatcctcgcactaaaaaggctgatcatgtggtgaatattgctaggtatctttac
catggaaacagcaatcctgaactagcttttgaaagtgccaagattttgtgctgtatttct
gataattccaacatccagataaaactagtaggtgatttcacacatgatcagagtgttagc
cagaagctgatggctgggtttgtggaatgtttagacaatgaagatgcagaagaattaatt
aatccagatgaggaactggagccggagaagaagcgggcacaaatccatcatgaaacaagg
atccatattctgaatctccttatcacctctcttgagtgcagtcctcccagcctagctctg
tatctcttggggtttgaactaaagaaacctgtcagcaccacaaatttgcaagatccaggt
gtcttgggttgcccacggacttgccttcatgctattttgaacatactggagaagggtact
gaaacaaggagtgggcctacagcagttcgggaatctccccatcttgcagaactatgttac
caggtgatctatcaattgtgtgcatgctctgacacttcaggtccaactatgagatacctg
aggaccagtcaggatttcttattcactcagctgcagtacttgccgttttctatcaaagaa
catgagatttcaacactcaaccaaatgtcttggctaatgaagactgcagctatagaaatg
cgagtgacatctctgaaccgccagcgctcccacacacagagactgctgcatctgctgctc
gatgacatgcctgtgaaaccatacctggctgatggtgaaggaggaatggaagatgaaagt
cgatcagtcagtggatttctccactttgacagtgcttccaaagtacgcagaaagatctta
aatatcctggattcaattgacttcagtcaggacattccagagcctttacaactggatttt
tttgaccgggctcaaattgagcaagtcattactaattgtgagcacaagaatgcacgtgga
caagtggtctgcaacgtcaagtacgttcacagagttctggttgcagaagtcaatgccctt
caaggaatggcagcaataggccagagacctttacttatggaggagatcaacactatcctg
cagtacgtcgtggagcgcaacaagctgctgcaatgcctccatgccaagaggcacgctctg
gagtcatggagacagctggtggaaatcatactcactgcctgcccccaggatctcattcag
gctgaggacaggcagctgattatccgggatctgttgcaggatgtgcatgacaagatcctt
gatgatgatgcagctcaggagttgatgccagtggtggcaggggctgtgttcactctgact
gcccacctgagccagtctgtgaaaacggagcagaaacagccacttgccctctctatggca
ggacagtcccaatatgtcttgatgctggatggttcttttacctcatcacctggctctgag
agcatatccatgggttttgcttctgttggtgactcctccctccacatcatcttaaaaaag
ctgctggatttcattttgaaaacaggtggtggcttccagagagtgaggacgcacctttat
ggatcattgctgtattatttgcagattgcccagagaccagatgaaccagacactttagaa
gcagctaaaaaaactatgtgggaacatttgacagctcctgaagatatgtttagtaaattg
caacgggaaaacatggcaactattgagagttatggggcagctctgatggaggtggtctgt
cgtgatgcttgtgatggccacgagataggacggatgctggcattggctttactcgatcac
attgtttcagtagacaagcagcagcagtggctgttgtatctctcgaatagtggctacctg
aaggtgcttgtggatagcctggcagatgatgatctggctctacagagcttgctcacacct
cagccccctttgcttaaggcactgtacacctatgagtccaaaatggcattcctcactcga
gtagccaaaagtcagcaaggtgcgttagagctgttgcggtccggtgtgattgtgcggctg
gcacagtgccaagtgtatgacatgcgacccgaaacagaccatcagggaatgtatgcaatg
agagatcccccagtcttcattcctactccagtggaacgttaccgccagattcttcttcca
gctcttcagctgtgccaagtgatcctcacatccagcatggcacaacacttgcaagccgcg
ggccaggttttacagttcctaatttcccattcagatactatccaggcaatcctgaggtgt
caagatgtaagtgttggatctctccaggagctggcctccctgacaggaataatcagcaag
gcggcattgcctggagtgctaaatgagctggatgtggatgttaatgaagggacacagatg
gagctacaaggacacatagggcgatttcagcgccagtgcttaggacttctgagtcggttt
ggaggatcagacaggctacgtcagttcaagctgcaagatgataacgtagcaggagacaga
gtgaacaagagggatgaaattgagttggcaatgcaacagatctgtgccaacgtgatggag
tactgtgagtcactgatgctgcaaagtgcccccagtttccagcacactgtttgtctgttt
actcccagcctatcagagtcaaccaatcgagatgggcctcggcaggatacacaaacacca
gtggtcccatattggcacttgcctggcctgggcattattgtttaccttctgaaacagagc
actagtgatttcttcagttattatgacagccatcgtcagaatgttaacaaactgcaaaat
gtggagcaactgccaccagatgaaataaaagagttgtgtcagtcagttatgccagctggg
gttgacaagatttccacttcccaaaaatacgtattggcaaggcggcgcctggtgaaacta
ataaataaccgagccaagttactctccctctgttcctatgtcatagaaatctgtctcttc
attctttggcgccatctggaacactacctactgcactgcacacccactgactcccaagac
ccactgctgtcctctaggatgtcatttaagaaaggaaggctgcaagattcctttggttct
gagccaagcttggatttcagtagtggactgaatcgagtgagccagcacgatatagaacag
cttcagattgaagccacaaacagctttggtgaatctctgcagaagaagctcctggacatc
gaaggtttatattccaagattcgctcgcggtacacctttattcaagctctcattagacgt
atccgtggtctcctaaggatatcaaggacctaa

DBGET integrated database retrieval system