KEGG   Taeniopygia guttata (zebra finch): 100232057Help
Entry
100232057         CDS       T01082                                 

Gene name
NUP205
Definition
nucleoporin 205kDa
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tgu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1A
AA seq 2171 aa AA seqDB search
MPALSLSRSRLEGTRRRRRRRPIHLRPRLLLRLSRGRPASRPLPVLRLSSEPAEPGRRPG
QAGRGEAARRGPGGQRGRAARLPVRFAGCGQARGERPPVRRYPGSAAQSCPAMELRGQSC
RHAWLVLAGSRGRQPRPPCLEGTVVTRNNLFSSFLYFKHIVLSLLLAASLWGPYKDIWQT
VMNAIWKRQPEAVHRLDQVLKKHKSDFISLFRNPPKNVQQHEKIQKASTEGVAIQGQQGT
RLLPEQLIREAFILSDLFDIGELAAVELLLAGEHQQPHFPGLTRGLVAVLLYWDGKRCIA
NSLRTLIQSRQGKTWTLELSQELISMTTRFTDDLMEQGLTQKILTLVSQIDLNNEFDKLQ
RERGLGSEKHRKEVSDLIKECRQSLAESLFVWTCQSPLSKDDTLILISYLEKVTVEADGS
LDGVNLSLLMALLYCFDVSFLEQGAEDREDLMHRLPLLAERQYIATIHTRLQESQPWKLP
GLQATVRLAWALTLRGISQFSDVTALAEFTEADEAMAELAIADYVFLFLTESVVASENFY
QEEFYIRKIHNLVTDFLALMPMKVKQLRNRADEDARMIHMSIQMGNDPPISLRRDLEHLM
LLIAELYRKDPFNLELAHEYWCPSEPLQTSTIMGSYLGVAHQRPPQRQVVLSKFVRQMGD
LLPSTIYIPYLKMLRGLASGPQCAHYCFSLLKVNGSSHAENIQGAGGSPVSWEHFFHSLM
LYHEHLRKDLPSADSVQYRHLPLRGITQKEQDGLIAFLQLTTVIVTWSENARLALCEHPQ
WTPVVVILGLLQCSIPPILKAELLETLTAFGRSPEIAASLWQSLEYTQILQTVRSPGQRQ
AIGIEVELNEIESRCEEYPLTRAFCRLISTLVESSFPANLGAGLRPPGFDPYLQFLRDSV
FLRFRTRAYRRAAEKWEVAEVVLEVFYKLLRDYEPQLEDFVDQYVELQGEEIIAYKPPGF
NLMYHLLNESPMLELCLSLLEEGVKQLDTYAPFPGKKHLEKAVQYCLALLNLTLQKENIF
MDLLRESHLSLIVTPLEQLLQGINPRTKKADHVVNIARYLYHGNSNPELAFESAKILCCI
SDNSNIQIKLVGDFTHDQSVSQKLMAGFVECLDNEDAEELINPDEELEPEKKRAQIHHET
RIHILNLLITSLECSPPSLALYLLGFELKKPVSTTNLQDPGVLGCPRTCLHAILNILEKG
TETRSGPTAVRESPHLAELCYQVIYQLCACSDTSGPTMRYLRTSQDFLFTQLQYLPFSIK
EHEISTLNQMSWLMKTAAIEMRVTSLNRQRSHTQRLLHLLLDDMPVKPYLADGEGGMEDE
SRSVSGFLHFDSASKVRRKILNILDSIDFSQDIPEPLQLDFFDRAQIEQVITNCEHKNAR
GQVVCNVKYVHRVLVAEVNALQGMAAIGQRPLLMEEINTILQYVVERNKLLQCLHAKRHA
LESWRQLVEIILTACPQDLIQAEDRQLIIRDLLQDVHDKILDDDAAQELMPVVAGAVFTL
TAHLSQSVKTEQKQPLALSMAGQSQYVLMLDGSFTSSPGSESISMGFASVGDSSLHIILK
KLLDFILKTGGGFQRVRTHLYGSLLYYLQIAQRPDEPDTLEAAKKTMWEHLTAPEDMFSK
LQRENMATIESYGAALMEVVCRDACDGHEIGRMLALALLDHIVSVDKQQQWLLYLSNSGY
LKVLVDSLADDDLALQSLLTPQPPLLKALYTYESKMAFLTRVAKSQQGALELLRSGVIVR
LAQCQVYDMRPETDHQGMYAMRDPPVFIPTPVERYRQILLPALQLCQVILTSSMAQHLQA
AGQVLQFLISHSDTIQAILRCQDVSVGSLQELASLTGIISKAALPGVLNELDVDVNEGTQ
MELQGHIGRFQRQCLGLLSRFGGSDRLRQFKLQDDNVAGDRVNKRDEIELAMQQICANVM
EYCESLMLQSAPSFQHTVCLFTPSLSESTNRDGPRQDTQTPVVPYWHLPGLGIIVYLLKQ
STSDFFSYYDSHRQNVNKLQNVEQLPPDEIKELCQSVMPAGVDKISTSQKYVLARRRLVK
LINNRAKLLSLCSYVIEICLFILWRHLEHYLLHCTPTDSQDPLLSSRMSFKKGRLQDSFG
SEPSLDFSSGLNRVSQHDIEQLQIEATNSFGESLQKKLLDIEGLYSKIRSRYTFIQALIR
RIRGLLRISRT
NT seq 6516 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgctctccctttcccgcagccgcctcgagggcacacgacgccgccggaggcgg
agacccattcacctgcggccgcggcttctcctccgcctctcccgcggccgtcccgcttcc
cggccgctgccagtcctgcgcctctcctccgagcccgcggaaccggggcgccgccctggg
caggccgggcgcggcgaagcggcgcggcgaggcccgggcgggcagcggggcagagctgcg
aggctcccggtgcggtttgcggggtgcgggcaggcgcggggagagcggcctcccgtgcgg
cggtacccgggctcggccgcgcagagctgcccggcgatggagctccgcggtcagagctgc
cgccacgcctggctggtcctggcgggaagtcgcggtaggcagccgaggcctccttgttta
gaggggactgtggtaactcgaaataatttgttttcttcctttctctatttcaaacacatt
gttttatctcttcttttagctgcaagcttgtggggtccatataaggacatatggcagact
gtaatgaatgccatttggaaaaggcaacctgaagctgttcatcgtctcgatcaagtttta
aagaagcacaaatctgacttcatttctctcttcagaaatccgccaaaaaatgttcagcag
catgagaaaattcagaaagcaagcacagaaggagttgctatccagggtcagcagggaact
aggcttttgccagagcagctcatcagagaagcctttatcctcagtgacctcttcgatatt
ggagagttggcagctgttgagctccttctagctggagaacaccaacagcctcactttcct
gggcttacaagaggtctagtggcggttctgttgtactgggatggaaaaagatgcattgcc
aattcactgcgaaccctcatccagtcacgccaaggcaagacgtggacattggaactcagt
caggagttaatttccatgacaacacgctttacagatgacctaatggagcagggtttgact
cagaagatccttacacttgtgtctcagattgatttgaacaatgaatttgataaacttcag
agagagcgaggattgggcagtgagaaacatcgaaaagaggtttctgatctcattaaagaa
tgccgacagtccttggctgaaagtctctttgtctggacctgtcagtcacccctgagtaag
gatgacactctaatcctcataagttacctggagaaggtaacagtggaagccgatggctca
ttggatggcgtgaacttgtctcttctcatggctctcctttactgttttgatgtcagcttt
ctggaacaaggggcagaggatcgtgaagacttgatgcaccggctccctctgctagcagaa
agacagtacatagcaacgatccacactcggcttcaggagtctcagccctggaaattacca
ggcctgcaagctactgttagattagcctgggcactgacattgcgaggcatatcccaattt
tctgatgtgacagctctagcagaattcactgaggcagacgaagcaatggcggagctagcg
attgctgattatgttttcctgttcctgactgaatctgttgtggcgtctgaaaatttctac
caggaggaattttacattcgcaaaatccataaccttgtcacggacttccttgcactcatg
ccaatgaaagtgaaacagctgagaaaccgtgctgatgaagatgctcgcatgatccacatg
agtattcagatgggtaacgatccacctatttcccttcggagagatctggagcatttaatg
cttctcatcgctgagttgtataggaaagacccctttaatctggaacttgcccatgagtac
tggtgtccgtcggagcccctgcagacatccaccatcatgggctcctatcttggagtagct
caccagcgaccccctcagcgccaggttgtcttgtcaaagtttgttaggcaaatgggagat
ctacttccttccacaatttacatcccatacttgaaaatgctgcggggactggctagtggg
cctcagtgtgctcattactgctttagtttgctaaaagtcaatggcagtagtcatgcggaa
aacatccaaggagcaggtggcagtcctgtctcctgggagcatttcttccactctttgatg
ctttatcatgagcacttaaggaaagacttgccaagtgcagacagtgtccagtaccgtcac
ctgcctctccgaggcatcacacagaaagaacaggatggattaattgcatttttacagctg
actactgttatagtcacttggagtgagaatgctcgcttggctctttgtgagcaccctcag
tggacaccagtagtggtcatcctgggacttctgcagtgcagcattcctcctattttgaaa
gcagagctattagaaacccttactgcttttggaagatctcctgaaatagctgcttcactc
tggcaatccctggaatatacacagatattacaaactgtgagaagtccaggccagagacaa
gcaattggtattgaggttgaattgaatgagattgagtcccgatgtgaggaatatccttta
actcgtgccttctgtcgactcatcagcactctggtggagagttcattcccagctaacctg
ggtgcaggtctccgccctccaggctttgatccctatctccagttcctcagggattctgtg
tttctccgattccgcacacgagcttatcggagagctgctgaaaaatgggaagtagctgag
gttgtcctggaagtgttttacaaattattgcgggactacgaaccacaacttgaagacttt
gtggaccaatatgtggagttacaaggagaagaaataatagcatataagccacctggattc
aatttgatgtatcatctgttgaatgagtccccaatgctggaactttgccttagtttgcta
gaagaaggggttaagcagcttgatacttacgctccatttcctgggaagaagcatttagag
aaagctgtacagtattgccttgcacttctaaacctaaccctacagaaggagaatattttt
atggatctgttgcgggagagccatctgtcccttattgtcacaccactggagcagctgctt
caaggaatcaatcctcgcactaaaaaggctgatcatgtggtgaatattgctaggtatctt
taccatggaaacagcaatcctgaactagcttttgaaagtgccaagattttgtgctgtatt
tctgataattccaacatccagataaaactagtaggtgatttcacacatgatcagagtgtt
agccagaagctgatggctgggtttgtggaatgtttagacaatgaagatgcagaagaatta
attaatccagatgaggaactggagccggagaagaagcgggcacaaatccatcatgaaaca
aggatccatattctgaatctccttatcacctctcttgagtgcagtcctcccagcctagct
ctgtatctcttggggtttgaactaaagaaacctgtcagcaccacaaatttgcaagatcca
ggtgtcttgggttgcccacggacttgccttcatgctattttgaacatactggagaagggt
actgaaacaaggagtgggcctacagcagttcgggaatctccccatcttgcagaactatgt
taccaggtgatctatcaattgtgtgcatgctctgacacttcaggtccaactatgagatac
ctgaggaccagtcaggatttcttattcactcagctgcagtacttgccgttttctatcaaa
gaacatgagatttcaacactcaaccaaatgtcttggctaatgaagactgcagctatagaa
atgcgagtgacatctctgaaccgccagcgctcccacacacagagactgctgcatctgctg
ctcgatgacatgcctgtgaaaccatacctggctgatggtgaaggaggaatggaagatgaa
agtcgatcagtcagtggatttctccactttgacagtgcttccaaagtacgcagaaagatc
ttaaatatcctggattcaattgacttcagtcaggacattccagagcctttacaactggat
ttttttgaccgggctcaaattgagcaagtcattactaattgtgagcacaagaatgcacgt
ggacaagtggtctgcaacgtcaagtacgttcacagagttctggttgcagaagtcaatgcc
cttcaaggaatggcagcaataggccagagacctttacttatggaggagatcaacactatc
ctgcagtacgtcgtggagcgcaacaagctgctgcaatgcctccatgccaagaggcacgct
ctggagtcatggagacagctggtggaaatcatactcactgcctgcccccaggatctcatt
caggctgaggacaggcagctgattatccgggatctgttgcaggatgtgcatgacaagatc
cttgatgatgatgcagctcaggagttgatgccagtggtggcaggggctgtgttcactctg
actgcccacctgagccagtctgtgaaaacggagcagaaacagccacttgccctctctatg
gcaggacagtcccaatatgtcttgatgctggatggttcttttacctcatcacctggctct
gagagcatatccatgggttttgcttctgttggtgactcctccctccacatcatcttaaaa
aagctgctggatttcattttgaaaacaggtggtggcttccagagagtgaggacgcacctt
tatggatcattgctgtattatttgcagattgcccagagaccagatgaaccagacacttta
gaagcagctaaaaaaactatgtgggaacatttgacagctcctgaagatatgtttagtaaa
ttgcaacgggaaaacatggcaactattgagagttatggggcagctctgatggaggtggtc
tgtcgtgatgcttgtgatggccacgagataggacggatgctggcattggctttactcgat
cacattgtttcagtagacaagcagcagcagtggctgttgtatctctcgaatagtggctac
ctgaaggtgcttgtggatagcctggcagatgatgatctggctctacagagcttgctcaca
cctcagccccctttgcttaaggcactgtacacctatgagtccaaaatggcattcctcact
cgagtagccaaaagtcagcaaggtgcgttagagctgttgcggtccggtgtgattgtgcgg
ctggcacagtgccaagtgtatgacatgcgacccgaaacagaccatcagggaatgtatgca
atgagagatcccccagtcttcattcctactccagtggaacgttaccgccagattcttctt
ccagctcttcagctgtgccaagtgatcctcacatccagcatggcacaacacttgcaagcc
gcgggccaggttttacagttcctaatttcccattcagatactatccaggcaatcctgagg
tgtcaagatgtaagtgttggatctctccaggagctggcctccctgacaggaataatcagc
aaggcggcattgcctggagtgctaaatgagctggatgtggatgttaatgaagggacacag
atggagctacaaggacacatagggcgatttcagcgccagtgcttaggacttctgagtcgg
tttggaggatcagacaggctacgtcagttcaagctgcaagatgataacgtagcaggagac
agagtgaacaagagggatgaaattgagttggcaatgcaacagatctgtgccaacgtgatg
gagtactgtgagtcactgatgctgcaaagtgcccccagtttccagcacactgtttgtctg
tttactcccagcctatcagagtcaaccaatcgagatgggcctcggcaggatacacaaaca
ccagtggtcccatattggcacttgcctggcctgggcattattgtttaccttctgaaacag
agcactagtgatttcttcagttattatgacagccatcgtcagaatgttaacaaactgcaa
aatgtggagcaactgccaccagatgaaataaaagagttgtgtcagtcagttatgccagct
ggggttgacaagatttccacttcccaaaaatacgtattggcaaggcggcgcctggtgaaa
ctaataaataaccgagccaagttactctccctctgttcctatgtcatagaaatctgtctc
ttcattctttggcgccatctggaacactacctactgcactgcacacccactgactcccaa
gacccactgctgtcctctaggatgtcatttaagaaaggaaggctgcaagattcctttggt
tctgagccaagcttggatttcagtagtggactgaatcgagtgagccagcacgatatagaa
cagcttcagattgaagccacaaacagctttggtgaatctctgcagaagaagctcctggac
atcgaaggtttatattccaagattcgctcgcggtacacctttattcaagctctcattaga
cgtatccgtggtctcctaaggatatcaaggacctaa

DBGET integrated database retrieval system