KEGG   Taeniopygia guttata (zebra finch): 100232138Help
Entry
100232138         CDS       T01082                                 

Gene name
USP45
Definition
ubiquitin specific peptidase 45
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100232138 (USP45)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100232138 (USP45)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 817 aa AA seqDB search
MRVKDPSRTNPEKPKRSKRPNRPQDEDSSDDISGLTCQHVSQAVDMHHVKRAVAQSVWSI
CAECLKERRVSDGEPGAPSDIWLCLKCGSQGCSKNSEGQHSLKHFQTARTEPHCIVINLS
TWIIWCYECDEELSTHCNKKVLAQIVDFLQKHGARAEPSSSKIIRLREENSETSEILKGK
TSGNGASVPVKGINNLGNTCFFNAVMQNLAQTHVLNELMYEIKEKGTKLKICHTSDSQLD
PLVVNLSSPGPLTSAMFLFLHSMREAGKGPLSPKVLFSQLCQKAPRFKGFQQQDSQELLH
YLLDAIRIEETKRIQTGILKAFNNPTTKTADEETRRKVKAYGREGVKMNFIDRIFVGELT
STVMCEECENISTVKEPFIDLSLPIIEERVAKPVPLGRTGKSKSVQEADLSQYNCSSLGT
LNNQPKIVKKHTLTKDKNQLNHERRLARKASSKEEERSPVIMQEKAKKLELEGSSGTVYS
KDPCAEAAVNGSQTEGSEKEASRSESSFDADSEASESESASKQTTLSPASSVSGVHINHL
NPKTPHNKPSDSNEEMISSAVSKLSFCDPVNEDKKSSCGDPALGLSNNSMFSVGKSSLSQ
NPQNAFQTLSQSYITSSKECSVQSCLYQFTSVELLMGNNKLLCESCTERKQKYQKKTNST
EKKMEGVYTNARKQLLISSVPAILILHLKRFHQAGLSLRKVNRHVDFPLILDLAPFCAAS
CKNVMDGARVLYSLYGIVEHSGSMRGGHYAAYVKVRTSSKKLLEHISTTKSVLGLKEAMG
ASGGQWVYVSDTHVQMVPESRVLNAQAYLLFYERLLL
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgaaagatccatcaagaaccaaccctgagaagccaaagagaagcaaaaggcct
aacaggccacaggatgaggactcttcagatgatatttcagggctaacatgccagcatgtg
agccaggcagtggacatgcaccatgtgaagagagcggtggctcagagcgtgtggtcaatc
tgtgcagaatgcctgaaggagaggcgggtgagcgatggtgagcctggggcgccttcagac
atctggctgtgtctcaaatgtggctctcagggctgtagtaagaattcggaaggccagcat
tctctgaaacacttccaaaccgcacgcacagaacctcattgcatcgttatcaacctcagc
acatggatcatatggtgttatgagtgtgatgaagagctgtcaacgcattgcaacaaaaag
gttctggctcagatagttgacttccttcaaaaacatggtgccagggctgaaccaagttca
tcaaaaatcatacgtcttcgtgaagaaaacagtgaaacaagtgaaatactgaaagggaaa
acctctggtaatggtgcatcagttccagttaaaggaataaataatttaggaaatacctgc
ttttttaatgctgttatgcagaacttggcacagactcatgttctaaatgaactgatgtat
gagataaaggagaaaggaacaaagttaaaaatctgtcatacttcagattctcaattggat
cctttggtggtaaacctgtccagcccgggacctttgacttcagcaatgttcttgttcctt
cacagcatgagggaggctggaaaaggtcctctgtctcctaaagtgctgttcagccagctt
tgtcaaaaggctcctcgatttaaggggttccagcagcaggacagccaggagcttctgcac
tatctgttggatgcaatcaggattgaggagacaaaacgtatacaaactggtatcttaaaa
gcattcaataacccaactactaagacagcagatgaagaaactagaagaaaagtcaaagca
tatggaagagagggtgtgaagatgaacttcatagataggatctttgttggtgaattgact
agcactgtcatgtgtgaggaatgtgaaaatatttcaacagtaaaagaacctttcattgat
ctttcacttcctataatagaggagagggttgcaaaacctgtgcccttgggaagaacaggt
aaaagtaaaagtgtacaggaggcagatcttagtcagtataattgttcttctctcggtact
ctgaataatcaacccaaaattgtcaagaaacacactttaacaaaagataagaatcaattg
aaccatgagagacggcttgccagaaaagcttcctcaaaggaagaagaaagaagtcctgtt
atcatgcaggaaaaagccaaaaagcttgagctggaaggtagctctggcactgtgtactcc
aaagacccctgtgcagaggcagctgtcaatggaagccagacagagggcagtgagaaggaa
gccagccgctccgaaagcagctttgatgcagacagtgaagcctcagaaagcgaaagtgct
tctaagcaaacaaccttgagcccagccagcagcgtgtctggtgtgcacatcaaccactta
aaccctaaaacgccgcacaacaagccaagcgacagcaacgaagagatgatttccagtgcc
gtatccaaacttagcttctgtgatcctgtaaatgaagataaaaaatcaagttgtggagat
ccagcattaggtttatcaaataattccatgttctcagtaggcaaatcctcactatcccaa
aaccctcaaaatgctttccagacactttcccaaagctatataactagctcaaaggaatgt
tctgttcagtcctgcctttaccagttcacctctgtagagctcttaatggggaacaacaag
cttttatgtgagagctgcacagaaaggaagcagaagtatcagaagaaaaccaactccaca
gaaaagaaaatggaaggtgtctacacaaatgctcggaaacagctgttgatttcttcagtt
cctgcgattcttattctccacctgaaaagattccaccaggctggtttgagtctacggaaa
gtaaacaggcatgtggatttcccattgattttagacttagcaccattttgtgctgcatct
tgcaagaacgttatggatggtgcaagagtgctgtatagtctttatggaatagtggagcac
agtggctcaatgagaggtggtcattatgcggcatatgtgaaagtcaggacatcctccaag
aaactgctagagcatatttctaccactaaaagtgttctgggtttaaaagaagccatggga
gcatcaggagggcagtgggtgtacgttagtgatacccatgttcagatggttccagaatca
agagtactaaatgcacaagcatatctacttttttatgaaagattattactctaa

DBGET integrated database retrieval system