KEGG   Taeniopygia guttata (zebra finch): 100232209Help
Entry
100232209         CDS       T01082                                 

Definition
histone H2B 1/2/3/4/6-like
Orthology
K11252  
histone H2B
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100232209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKTQKKGDKKRKKSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagccggccaagtccgcccccgcgcccaagaagggctccaagaaggcggtgacc
aagacgcagaagaagggcgataagaagcgcaagaagagccgcaaggagagctactccatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggtgaggcgtcgcgc
ctggcgcactacaacaagcgctccaccatcacctcgcgggagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggctgtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system