KEGG   Taeniopygia guttata (zebra finch): 100232212Help
Entry
100232212         CDS       T01082                                 

Gene name
HKDC1
Definition
hexokinase domain containing 1
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100232212 (HKDC1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100232212 (HKDC1)
   00051 Fructose and mannose metabolism
    100232212 (HKDC1)
   00052 Galactose metabolism
    100232212 (HKDC1)
   00500 Starch and sucrose metabolism
    100232212 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    100232212 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    100232212 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100232212 (HKDC1)
Enzymes [BR:tgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100232212 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 879 aa AA seqDB search
MLAVHLLAFHFTKLKEDQIKKVDRYLYQLRLSDDVLLDVTARFQAEMGKGLARDTSPTAA
VKMLPSFVRSLPDGSEKGDFLALDLGGSQFHIHWVKEFDDGKQSSQLESKSYPTPKEVTQ
GNGAELFDYIADCLSDFMDTKNLKHKKLPLGFTFSFPCKQTKLEEGVLLAWTKHFRVRGV
QDTDVVSSLHRALQKHQDIDVDVLALVNDTVGTMMTCGYDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGALDDLRTEFDRELDLGSLNPGKQLFEKMISSL
YLGELVRLILLKMTKEGLLFNGKVSTALLTKGKIEMKHVSAMEKYKEGLSNTKEILTELK
LFPSEEDCVAVQHVCAVVSSRSAKLCAAALAAILTRLRENKQLLRMRTTVGIDGGLYKTH
PKFAGRLHRAVGRLVPACEVRFLRSRGGSGRGAAVVAAVERRLARMTQARSSVKMLPTFV
LSSPSEKGKFLALDLGGTNFRVLLVKIKSGRRRSVQMYNKIFAIPLEIMQGTGEELFDHI
VQCIADFLEYMGIKGARLPLGFTFSFPCRQASIDKGTLVGWTKGFKATDCEGEDVVDMLR
EAIRRRNEFDLDIVAVVNDTVGTMMTCGYEDPNCEIGLIAGTGTNVCYMEDMKNIEIVEG
NEGKMCINTEWGAFGDNGCIDYIRTKYDREVDEGSLNPGKQRYEKMTSGMYLGEIVRQIL
IDLTKQGLLFRGHISESLRKKGIFETKFLSQIERDRLALPQVRHVLRQLGLDSTCEDSII
VKEVCAAVSTRAARLCGAGLAAVVEKKRENQGVERLQITVGADGTLYKLHPHFSRILQET
VKELAPQCDVSFMLSEDGSGKGAALITAVAKRLHNVGQK
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgttggctgtccacttgctagctttccatttcacaaagctaaaagaggatcaaataaaa
aaggtggacaggtacctgtaccagctgcgcctctccgacgatgtcctgctggatgtcaca
gctcgcttccaggccgagatggggaaggggctggccagagacacgagccccacggcagcg
gtgaaaatgctgccctcgtttgtgcgctcgctgcccgatggctcagagaagggtgacttc
cttgctctggacctgggcggctcccagtttcacatccactgggtgaaggagtttgatgat
gggaagcagagcagccagctggagagcaagtcctaccccacacccaaggaggtgacgcag
gggaacggagccgagctctttgattacattgctgactgtctgtcagacttcatggacacc
aaaaacctgaagcataagaagttacctcttggatttacgttttcttttccgtgcaaacag
accaagctggaggagggggttcttcttgcgtggacaaaacacttcagggtccgaggagtt
caggacacagacgtggtgagctctctgcacagggccctgcagaagcaccaggacatagat
gttgatgttctggcactggtcaatgacacggtgggaaccatgatgacttgtggatatgat
gaccagcgctgtgaagttggactcataattgggacgggcaccaacgcctgctacatggag
gagatgaggcacatcgacctggtggagggggatgaagggaggatgtgcattaacacggag
tggggggccttcggagacgacggtgctttagatgacctccgcacagagtttgatcgggag
ctggatctgggatctctcaaccctggaaaacaactgtttgagaagatgatcagcagcctg
tatctgggggaacttgtgagactcattctcctaaaaatgacaaaggaaggtctgctcttc
aatgggaaagtgtcgacagctctgcttactaagggcaagattgaaatgaaacacgtgtct
gcaatggaaaagtacaaggaaggcctgagcaacacaaaagagatccttacagagctgaag
ctgtttccctctgaggaggactgtgttgctgttcagcacgtctgtgccgtcgtttcctcc
cgctcggccaagctctgcgccgccgccttggcagccatcctcacccggctccgggagaac
aagcagctgctgaggatgcgcaccactgtggggattgatggggggctctacaaaacccac
cccaagttcgccggccgcctgcacagggcggtgggcaggctggtgcccgcgtgcgaggtg
cggttcctgcggtcgcggggcggcagcggccggggggccgcggtggtggcggcggtggag
cgcaggctggcgaggatgacgcaggccaggtcatcggtgaagatgctgcccacgttcgtc
ctttcttctccttcagagaaaggaaagttccttgcccttgacctcggtggcacaaatttc
agggttctgctggtcaaaatcaaaagcgggagaagaagatcagtgcaaatgtataacaaa
atctttgccattcctttggagatcatgcaagggacaggagaagagctctttgaccatatt
gtccagtgcatagcagactttctggagtatatggggattaaaggtgctcgtcttcctctg
ggcttcaccttctctttcccctgcaggcaagccagcattgacaagggaacgcttgtggga
tggacaaaaggattcaaggcaacagactgtgagggggaagatgttgttgatatgctaaga
gaggctatcaggagaagaaatgagtttgacttggacattgtagcagtggtgaatgacact
gttgggaccatgatgacttgtggctatgaggatccaaactgtgagattggccttattgca
ggaacaggcaccaatgtttgctacatggaggacatgaaaaacatagaaatagtggaaggg
aatgaaggaaaaatgtgtattaatacagaatggggagcatttggtgacaatggctgcatt
gactacatcaggacaaaatatgatagagaagtagatgaaggctcattaaacccagggaaa
cagaggtatgaaaagatgaccagtggaatgtacctaggtgaaatagtaaggcaaattttg
attgacttaaccaaacaagggctgctgttcagaggacacatttcggaatctctcaggaaa
aaaggcatatttgaaacaaaattcctgtctcagattgagagggaccggctcgccctcccg
caggtgcggcacgtcctgcggcagctgggcctggacagcacctgtgaggacagcatcatc
gtcaaggaggtgtgtgcagctgtttcaacaagagctgcccggctctgtggggcaggcctg
gctgctgttgtggagaagaagagggagaaccaaggtgtggagcgcttgcaaatcactgtt
ggagcagatgggactctgtacaagctccatccgcatttttctaggatcctgcaggaaaca
gtgaaggagctggcccctcagtgtgatgtgagtttcatgctttctgaagatggaagtggg
aagggagctgccctcattactgcagttgcaaaaagattgcataatgttggacagaagtag

DBGET integrated database retrieval system