KEGG   Taeniopygia guttata (zebra finch): 100232312Help
Entry
100232312         CDS       T01082                                 

Definition
histone acetyltransferase KAT7-like
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100232312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
27
AA seq 339 aa AA seqDB search
MAATPLPAPLTAAAIAAPSPRRNAGSSSDGTEDSDFSTDPEHTDSSESDGTSRRSARVTR
SSARLSQSSQGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLAHRQDDN
NRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRLTYGNTREPLLENLTS
EYDLELFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLG
RLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCL
LAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcggccacgcccctccccgctcccctcacggccgccgccatcgccgccccctcacca
cgaaggaacgcgggcagcagctcggatggcaccgaggactcggatttctccacggacccc
gagcacacggacagctccgagagcgacggcacctcccgcagatccgcccgcgtcacccgc
tcctcggcccggctcagccagagctcccagggacacctgaccgggaagcacgagcgccac
ttctccatctcgggctgccctctctaccacaacctgtcagcagatgagtgcaaggtgcga
gcgcagagccgggacaagcagattgaggagcggatgttggcccacaggcaggatgacaac
aacaggcacgccaccaggcaccaggcccccacggagaggcagctgcggtacaaggagaag
gtggctgagctcaggaagaagaggaactcggggctcagcaaggagcagaaggagaaatac
atggagcacaggctaacctatggcaacaccagggagcctctcctggagaacctgaccagc
gagtacgacctggagctgttccgcagggctcaggcccgcgcctccgaggacctggagaag
ctgaggctgcaggggcagatcactgagggcagcaacatgatcaagaccatcgcgttcggg
cgctacgagctggacacgtggtaccactcgccctaccccgaggagtacgcgcgcctcggg
cgcctctacatgtgcgagttctgcctcaagtacatgaagagccagaccatcctgcgcagg
cacatggccaagtgtgtctggaagcacccgccgggggacgagatctaccgcaagggctcc
atctccgtgttcgaggtggacggcaagaagaacaagatctactgtcagaacctgtgtctg
ctggcaaagcttttcctggaccacaaaaccctttattatgatgtggaacccttcctcttc
tatgtcatgacggaggctgacaacaccggctgccacctgatcgggtatttctccaag

DBGET integrated database retrieval system