KEGG   Taeniopygia guttata (zebra finch): 100232535Help
Entry
100232535         CDS       T01082                                 

Gene name
PLB1
Definition
(RefSeq) uncharacterized LOC100232535
  KO
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100232535 (PLB1)
   00565 Ether lipid metabolism
    100232535 (PLB1)
   00590 Arachidonic acid metabolism
    100232535 (PLB1)
   00591 Linoleic acid metabolism
    100232535 (PLB1)
   00592 alpha-Linolenic acid metabolism
    100232535 (PLB1)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100232535 (PLB1)
    3.1.1.5  lysophospholipase
     100232535 (PLB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 706 aa AA seqDB search
MEKALLSEDVPNTFATAKWANNADILKKFNPNLFGFSTGTSKETAGFNVAERNATARDMP
AQARALVELMRSSSKINFKEDWKLITILVGGSDLCQYCLDKETYSVQKYVMHLQDTLDIF
YEEKINFKEDWKLITILVGGSDLCQYCLDKETYSVQKYVMHLQDTLDIFYEEAEALRLIS
GGRYEQREDFAVVIQPFLRNTLLPLDSTSKPDMSFFAADCFHFSVRGYAEMAMALWNNML
EPVGEKQTYNNFTHDRSKLRCPNPDKPFLSTRRNSGFGNSDLSLEKTESSVPYWAVIVAA
VGGILAARWQSCGGGATRLTQTLRARSSPSRGPGPLRACAAEPAAPARCRSAGRPQPPAA
HMRPAACGFTLEGSSRKPTQALMSTKLPSTVEYLISVRGCRPGKIVQMTEAEVRGLCIKS
REIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLE
TICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIA
AIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRG
VSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGM
MSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagcactgctcagtgaagatgttccaaacacctttgctactgcaaagtgggca
aacaatgcagacatcttgaaaaaattcaatccaaacctctttggcttctccactggcact
tctaaggaaacagctggattcaacgttgcggagagaaatgccacagcacgtgatatgcca
gcccaggcacgtgcattggtggagctgatgagaagcagctccaaaattaacttcaaggaa
gactggaagctgattaccatccttgttggaggcagcgacctgtgccagtactgcttggac
aaggaaacctattcagtgcaaaagtatgtaatgcaccttcaggacactctggatattttc
tatgaggagaaaattaacttcaaggaagactggaagctgattaccatccttgttggaggc
agcgacctgtgccagtactgcttggacaaggaaacctattcagtgcaaaagtatgtaatg
caccttcaggacactctggatattttctatgaggaggctgaagccttgcggctgatcagc
ggcggtcggtacgaacagcgggaggactttgccgtggtcatccagccattcctcaggaac
accttgctgcccctggatagtactagcaagccagatatgagtttctttgctgcagactgc
tttcatttcagtgtaagaggctatgctgagatggccatggctctctggaacaatatgctg
gagccagttggtgaaaagcagacttacaacaactttacccatgacagatcaaaactcaga
tgtccaaaccctgataaaccttttctttccacgagaagaaatagtggatttggaaattca
gatctcagcttggagaaaacagaatcttcagtcccttactgggcagtcattgtggctgca
gtaggggggatcctggctgcgaggtggcagagttgcggcggaggggcgacccggctgaca
cagacgcttcgggctcgttcttcgccctcacgcgggccgggcccgctccgcgcctgcgcc
gccgagcccgccgcgcctgcgcgctgccggagcgcggggcggccgcagcctcctgctgct
cacatgcgccctgctgcttgtggattcactctagagggaagctcaagaaagcccacccag
gccctgatgtccacaaagttaccttcaactgttgaatatctcatttcagtacgaggatgt
cgtcctgggaagattgttcagatgaccgaagcagaagttcggggcttgtgcataaaatca
cgggaaatatttcttagccagcctattcttctggaactagaggcacctctgaaaatttgt
ggtgatatccatggccagtatacagacttgcttcgattatttgaatatggaggattccca
ccagaagctaattatcttttccttggagattatgtagacagaggcaaacagtctctggaa
acaatttgcctattactggcatataaaatcaagtacccggaaaacttctttctcctaaga
ggaaatcatgagtgtgctagcatcaatcgcatctatggattttatgatgaatgcaagcgg
agatttaacattaagctgtggaaaaccttcacagactgttttaactgcctgcctattgca
gccattgtggatgagaagatcttctgttgtcatggaggactgtctccagatctccagtca
atggagcagatccggagaattatgagacctacagatgttcctgacacaggtttgctctgt
gacctgctgtggtctgacccagacaaagatgtgcaaggttggggtgaaaatgatcgtggg
gtctctttcacttttggtgctgatgtggtcagtaaatttctgaatcgtcatgatctggat
ttgatctgtcgagctcatcaggtggttgaagatggatacgagttctttgctaaacggcag
ttggtcaccctattctcagctccaaactattgtggagagtttgacaatgcagggggcatg
atgagtgtggatgaaactctgatgtgttccttccagatattgaaaccatctgaaaagaaa
gccaagtaccagtatggtggactgaattctgggcgtccagtcactccacctcgcacagct
aacccaccgaagaagaggtga

DBGET integrated database retrieval system