KEGG   Taeniopygia guttata (zebra finch): 100232589Help
Entry
100232589         CDS       T01082                                 

Gene name
SOS2
Definition
son of sevenless homolog 2 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100232589 (SOS2)
   04012 ErbB signaling pathway
    100232589 (SOS2)
   04630 Jak-STAT signaling pathway
    100232589 (SOS2)
   04068 FoxO signaling pathway
    100232589 (SOS2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100232589 (SOS2)
  Cellular commiunity
   04510 Focal adhesion
    100232589 (SOS2)
   04540 Gap junction
    100232589 (SOS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100232589 (SOS2)
   04912 GnRH signaling pathway
    100232589 (SOS2)
  Development
   04320 Dorso-ventral axis formation
    100232589 (SOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1394 aa AA seqDB search
MPPGKKRNIIQAGQNTACSQRHANAAAAIQVPNEENGPKKRGLFVPALRKVQQQVHPNLS
AKEDSLFYIEELILQLLHKLCIAQPRTVQDVEVQQQVHPNLSAKEDSLFYIEELILQLLH
KLCIAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVEKIHPLLKEV
LGYKVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHFEISQQDIKVSMCADKVLMDMFD
QDEIGLVSLCEDEPSSSGELNYYDLVRNEIAEERQYLRELNLIIKVFREAFLSNRRLFTP
HDIDVIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLS
QDILSPQFHEHFNNLMAKPAVALHFQSTAEGFKEAVQYVLPRLMLIPVYHCLHYFELLQQ
LQECSEDEEDRECLKQAITALLNLQCSMERIYSKHSPRRRPGEPVCRFYHRQIRSKHLAI
KKMNEIQKNIDGWEGKDIGQCCNEFIMEGGLTKIGAKHERHIFLFDGLLISCKTNHGQSR
LPGYSSAEYRLKEKIVMRKMQVVDKEDTAEYRHAFELVSKDDSSVLFAARSAEEKSTWMA
ALISLQYRSTLDRMLDSVLLQEENEQPLRLPSPSVYRFVVEDSEENIVFEDNLQSRNGIP
IIKGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEAD
RLAIEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLETFIS
SVRGKSMKKWVESIAKIIKRKKAQADGVSHNITFESPPPPLEWHLWRVGHSEALELMTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKKRV
LDEAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRQGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVEPEIRKFFENLNPMGKIPEKEFTDYLFNKSLEIEPRN
CKQPPRFPRKTTYPLKSPGIRPNTGRHGSTSGTLRSHPLPLEKEPSKISFSRITEAEQET
TASAPTSPNTPSTPPVSASSEFSVFLDIDLNSSYGNNSIFAPVNLPPSKTFFSSWGSFPK
LSDEPQNPPPLPPRKKMDQDASNAKGNSKSDDDPPAIPPRQPPPPKIQPRVPAYSGPLEQ
PLHSPPPPPPRDPVPDTPPPVPLRPPEHFINCPLSLQPPPLGRFPRDPEWLREAGSGPSS
PGTPPSTPSPRVLRRCCVLSASHNNLAQPPVPPVPPRHNSSPQLPKLPPKTYKRELSHPP
LHRLSLLENAETPQ
NT seq 4185 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaggtaagaagaggaacatcatccaggcagggcaaaacacagcctgcagccaa
cgacatgcaaacgccgctgcagccatacaagttcctaacgaggagaacggcccgaaaaag
cgcggcctattcgtgcccgccttgcgcaaggtgcagcagcaggttcaccccaacctgtca
gccaaggaggattccctgttctacattgaggagctgatcctgcagctgctgcacaaactg
tgcatcgcccagccacgcacggtgcaggatgtggaggtgcagcagcaggttcaccccaac
ctgtcagccaaggaggattccctgttctacattgaggagctgatcctgcagctgctgcac
aaactgtgcatcgcccagccacgcacggtgcaggatgtggaggagcgggtccagaagacg
tttccccaccccatagacaagtgggccatcgctgatgcgcagtcggccatcgagaaacgg
aaaagaaggaaccccctcctgctccctgtggagaaaatccatcccttactgaaggaggtc
ctgggctacaaggtggattaccatgtctctctttatattgtggctgtcttggaatatatc
tcagctgacattttaaagctggctggaaactatgttttcaatatccgacactttgagatc
tcccagcaggacattaaagtatcaatgtgtgctgataaggttttgatggatatgtttgat
caggacgagattgggttggtttccctgtgtgaggacgagccctcctcttctggggagctc
aactactacgacctggtgagaaatgagattgcagaagaaaggcaatacctgagggagctg
aacctgatcatcaaagtatttcgggaagcttttctgtccaacaggagactcttcacacct
catgacattgatgtgatattcagcaacatttcagacatccacgagctgacagtgaagctt
ttgggattgattgaggacactgtggaaatgacagatgaaagcagccctcaccctctggct
ggcagctgctttgaggacctggcagaggagcaagcctttgatccatatgaaaccttgtcc
caggatattctttctccacaatttcatgagcattttaacaacttaatggccaaacctgct
gtggctctccacttccagtccacagctgaaggatttaaggaggctgtccagtatgtcctg
cctcgcctcatgctgatcccagtctatcactgcttgcactactttgagttgctgcagcaa
ttgcaggagtgcagtgaggatgaagaggacagggagtgcctgaagcaggccatcactgcc
ctgctgaacctgcagtgcagcatggagcgcatctacagcaagcactccccgcggcgccgg
cccggggagccggtctgtcgcttctaccaccggcagatcagaagcaaacacttggccatc
aagaaaatgaacgaaatccagaaaaacatcgacggctgggaaggcaaagacatcggccag
tgctgcaacgagttcatcatggaaggagggctgacaaaaatcggggccaagcacgagcgc
cacatcttcctcttcgacggtttgctgatcagctgcaaaaccaaccacgggcagtcgcgg
ctgcccggctacagcagcgccgagtacaggctcaaggagaagatcgtcatgaggaagatg
caggtggtggacaaggaggacacggcagagtacaggcacgccttcgagctggtgtccaag
gacgacagcagcgtcctgttcgccgccaggtcggccgaggagaagagcacgtggatggcg
gcgctgatctcgctgcagtaccgcagcaccctggacaggatgctggactcggtgctgctg
caggaggagaacgagcagcccctgaggctgcccagccccagcgtgtatcgtttcgtggtg
gaggactccgaggagaacattgtttttgaggacaacttgcagagcaggaatggaattccc
atcatcaaagggggcacggtggtgaagctcatcgagaggctgacctaccatatgtatgca
gatcctaactttgttcggactttcctgaccacctatcgctccttttgcaagccccaggag
ctgctgagtttgctgatagaaaggttcgagatccctgagcctgagcccacggaggcagac
aggctggccatcgagaagggggagcagcccatcagcgccgacctgaagcgcttccgcaag
gaatacgtgcagcccgtgcagctcagaatactgaatgttttccggcactgggtcgagcac
catttttatgattttgagagggatctggagctgctggagaggctggagaccttcatttcc
agtgtcagaggaaaatccatgaagaagtgggtggagtccattgctaaaatcatcaagagg
aagaaagcccaggcagatggggtgagccacaacatcaccttcgagagccccccgccgccg
ctggagtggcacctgtggcgcgtggggcacagcgaggccctggagctgatgacgctgcac
cccatcgagatcgcccggcagctcaccctgctcgagtccgacctgtacagggctgtgcag
ccttctgaactcgttggcagtgtgtggacgaaggaagataaggaaatcaactccccaaat
ctcctgaaaatgattcgtcacactacaaatctcactctgtggtttgaaaagtgcatcgtg
gaaacagagaactttgaggagcgagtggctgtgctgagcaggatcatagaaatcctgcag
gttttccaagacctcaataatttcaatggtgttctggagattgtcagtgctgtgaactct
gtctcagtgtacaggctggaccacacatttgaggcactccaggaaaggaaaaagagagtt
ttggatgaagcagtagaattaagccaagatcattttaagaagtatttagctaagctcaag
tcaatcaaccctccctgtgtgcctttttttggaatatacctaacaaatatcttgaagaca
gaagaagggaatcctgacttccttaaaagacaagggaaagaattaattaacttcagtaag
aggagaaaagtggctgaaattacaggagaaattcagcagtatcaaaaccagccctactgc
ttacgggttgagccagaaatccggaaattctttgaaaatctcaatcccatggggaagata
ccagaaaaagagtttacagattatctgttcaacaagtccttagagattgaacctcggaac
tgcaagcaaccacctcgatttcccaggaaaacaacgtatcccctgaaatcccctgggatc
aggcccaacacgggcaggcacggctccacctcgggcacgctgaggagccaccccctgccc
ctggaaaaggagcccagcaagatcagcttcagcaggatcaccgaggccgagcaggagacc
acagcatcggcaccgacctcccccaacaccccctcaacgccgcccgtgtcggcgtcctcg
gagttcagcgtcttcttggacattgatctcaacagttcttatggtaacaacagcatcttc
gctcctgtgaacttgcctccatcgaagactttcttcagctcctggggaagctttcctaaa
ctgagtgatgaacctcagaaccctcctccacttcctccacgaaaaaagatggatcaggat
gcttccaatgctaagggaaattccaagtcggatgacgatcctccagcaatcccccctcgg
cagccgcctcctccaaagatccaacctcgcgttcctgcttacagcggccccctggagcag
cccctgcacagccctcctcctccgcccccccgggaccccgtccccgacaccccaccgccg
gtgccgctccggccgcccgagcacttcatcaactgccccctgagcctgcagccgccgccg
ctgggacgcttcccccgggatcccgagtggctgcgggaggccggctccggccccagctcc
ccgggcacccctcccagcaccccctctccccgggtgctgcgccgctgctgcgtcctcagc
gccagccacaacaacctggcgcagccgcccgtgccccccgtgccgccccggcacaactcc
agcccccagctaccaaaactgccaccaaagacttacaaaagggagctctcccaccctcct
ttgcacagactgtctttgctagaaaatgcagaaacgcctcaatga

DBGET integrated database retrieval system