KEGG   Taeniopygia guttata (zebra finch): 100232652Help
Entry
100232652         CDS       T01082                                 

Gene name
CACNA2D2
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 2
Orthology
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100232652 (CACNA2D2)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100232652 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    100232652 (CACNA2D2)
Ion channels [BR:tgu04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100232652 (CACNA2D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 1068 aa AA seqDB search
MQYWARRLEQEIDGVMRIFGGVQQLRKIYDDNKSLFEVKENVPRKLVEKVAGDIESLLAK
KVRALKRLANAAEKFQKAHHWQDNIREEDIEYYDSKADTEYDDPDGEEIEREKSNSLKLE
FTDDDNFKTKVNYSYAAVQIPTDIYKGSTVILNELNWTQALEDVFIENRKEDPSLLWQVF
GSATGVTRYYPATPWRAPNKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLM
KTSVYEMLDTLSDDDYVNVASFNEKAKPVSCFKHLVQANIRNKKVFKEDVQGMVAKGTTD
YKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYKWPNKTVRVFTFSVGQ
HNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGNRAKQVQWTNVYQ
DALGLGLVVTGTLPVFNLTEDSSDRKVGDSAAGIPGVLPALHHLPAVTPGVTLGANGYVF
AIDLNGYVLLHPNLQPQIINFREPVTLDFLDAELEDENKEEIRRSMIDGNDGQRFIKTLI
KSLDEQYIDEVFRTYTWAPIKSTNYSLGLVLPPYSTYYIQANLSDQILQVKYFEYLLPNS
FESEGHVFIAPREYCKDLDLSDNNTEFLENFIALMEKVTPDSKQCDNFLLHNLILDTGIT
QQLVDQVWKDQDLNTYSLLAVFASTDGGITRIFPNKAADDWEEEPEPFNASFYRRSLDNK
GYIFKPPYRDAGYRGLDLENNTIGILVSTAVELSIGGKTLKPAVVGVKLDLEAWAEKFKV
LASNRTDRDQLGTRRCDPSSSCEMDCEANNKDLICVLIDDGGFLVLSNQEDHWYQVGKFF
SEVDANLMSALYNNSFYARKESYDFQSVCAPEAPSNTGAAPRGVFVPTVADLLSLAWWTS
AAAWSLFQQFLYSLTYSSWFQTEEVVGDGMEARETSCIMKQTQYYFSTVNATYNAIIDCG
NCSRWVHPRFTMLFVVADKPLCSQCESVKLLQAEVRAPPRDPNQCELVDRPRYRKGPHIC
FDYNATEDTSDCGRGASFSPSLGVLLSLQLLLLYSSTSRHPLPPAACL
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgcagtactgggccaggaggctggagcaggagattgacggagtgatgaggatatttggt
ggagtccagcagctcaggaagatctatgatgacaataaaagcctatttgaagtcaaggag
aatgtgcctaggaaattggtggagaaggtcgcaggggacattgagagcctcttggccaag
aaagtccgtgctttaaagagacttgccaacgcggcggagaaattccagaaggctcaccac
tggcaggacaacatccgggaggaagacatcgagtactacgactccaaggccgacactgaa
tatgacgaccccgatggagaagagatcgagagggagaagtccaactccttgaagctggag
ttcactgatgatgacaacttcaagaccaaggttaattattcctacgctgccgtgcagatc
cccacggacatctacaaaggctccactgtcatcctcaacgagctgaactggacgcaggcc
ctggaggacgttttcatcgagaaccggaaggaggatccctccctgctctggcaggtcttc
ggcagcgccaccggcgtcacccgctactaccccgccaccccatggagagcccccaacaag
atcgacctctacgacgtgcgccggcggccctggtacatccaaggtgcctcctccccaaag
gacatggtcatcattgtggacgtgagtggcagtgtgagcggcctcaccctcaagctgatg
aagacctcagtctatgagatgctggacaccctctcagatgatgactatgtcaatgtggcc
tcgttcaatgaaaaggcaaagccggtgtcgtgcttcaagcacctggtgcaggccaacatc
cggaacaagaaggtgttcaaggaggacgtgcagggcatggtggccaagggcacaacagac
tacaaggctggctttgagtacgccttcgaccagctgcagaactccaacatcacacgtgcc
aactgcaacaagatgatcatgatgttcacggacggcggtgaggaccgagtgcaggatgtc
tttgagaagtacaaatggcccaacaagacggtgcgggtcttcaccttctccgtggggcag
cacaactacgacgtgaccccgctgcagtggatggcctgtgccaacaaaggttactacttc
gaaatcccctccatcggcgccatccgcattaacacgcaggagtacctggatgtgctgggc
agacccatggttctggctgggaaccgagccaagcaggtccagtggaccaatgtctaccag
gatgccctggggctgggcttggtggtgacaggaacgctgccagtgttcaacctgacagag
gacagcagtgacaggaaggtaggagactctgctgctggcatccctggggtgctgcctgct
ctgcaccacctccctgcagtgacaccaggggtgactctgggggccaatggctacgtcttc
gccatcgacctgaacggctacgtcctgctgcaccccaacctgcagccccagatcatcaat
ttccgtgagccagtgacgctggacttcctggatgctgagctggaggatgaaaacaaggag
gagatccggagaagcatgattgatgggaatgatgggcagaggttcatcaagaccctcatc
aagtccctggatgagcaatacatcgacgaggtgttccggacctacacgtgggctcccatc
aaaagcaccaactacagcctggggctggttttgcctccctacagtacctactacatccag
gccaacctcagcgaccagatcctgcaagtgaagtattttgaatacctgctgcccaacagc
tttgagtcggagggacatgtgttcattgcgcccagagagtattgcaaagacctcgacttg
tcggataacaacaccgaattcctggaaaactttattgccctcatggaaaaggtgacccca
gactccaagcagtgcgacaacttcctcctgcacaacctcatcctggacacgggtatcaca
cagcagctggtggatcaagtctggaaggaccaggatctcaacacgtacagcctcttggct
gtcttcgcatccactgatgggggcatcacccgtatcttccctaacaaggctgcagatgac
tgggaggaggagccggagcccttcaatgccagcttctaccggaggagcctggacaacaag
ggctacatcttcaagccaccctaccgagatgctggctaccgggggctggacctggagaac
aacaccattgggatcctggtgagcaccgccgtggagctcagcatcgggggcaagactctg
aagcccgcagtggtgggggtgaagctggacctggaggcctgggctgagaagttcaaagtg
ctggcgagcaaccgaacagaccgggaccagctgggcacccgcaggtgtgacccctcaagc
agctgtgagatggactgtgaggccaacaacaaggacctcatctgtgtcctgatcgatgat
gggggcttcctggtgctctccaaccaggaggaccattggtaccaggtgggcaagttcttc
agcgaagtggatgccaacctgatgtctgccctctacaacaactccttctacgcccgcaag
gaatcctatgacttccagtccgtctgtgcccctgaggcccccagcaacacgggcgcggcg
cctcgcggcgtcttcgtgcccaccgtggccgatctcctgagcctcgcctggtggacctca
gccgcagcctggtccctgttccagcagttcctgtacagcctcacctacagcagctggttc
cagacggaggaggtggtgggggacggcatggaggccagggagacgagctgcatcatgaag
cagacccagtattacttcagcaccgtcaacgccacctacaacgccatcatcgactgcggc
aactgctccaggtgggtccatccccgcttcaccatgctcttcgtggtggctgacaagccc
ctctgcagccagtgtgagtctgtcaagctgctgcaggcagaggtaagagcccccccgagg
gaccccaaccagtgtgagctggtggacaggccccgctaccggaaaggcccccacatctgc
ttcgactacaatgcaacagaagatacctcagactgcggccgaggggcttccttctccccc
tccctgggggtcctgctctcgctgcagctgctgctcctctactccagcaccagccggcac
ccactgcccccggccgcctgcctttag

DBGET integrated database retrieval system