KEGG   Taeniopygia guttata (zebra finch): 100232653Help
Entry
100232653         CDS       T01082                                 

Gene name
GYS2
Definition
glycogen synthase 2 (liver)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100232653 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100232653 (GYS2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100232653 (GYS2)
Glycosyltransferases [BR:tgu01003]
 Polysaccharide
  Storage polysaccharide
   100232653 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1A
AA seq 704 aa AA seqDB search
MPLARSLSMTSLNGLLQCEDEDLPVEDLLLFEISWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEQNVKTQVEFSEPPNPAVKKAMDAMKSQGCQVFFGRWLIEGSPYVLLFDI
GSAAWNLDKWKGGFWEVSNIGIPFHDREANDAVIFGSLTAWFLKELSCQFDDKPNIIAHF
HEWQAGVGLILSRSQKLPVATIFTTHATLLGRYLCAASIDFYNNLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITATEAEHMLKKCPDVVTPNGLNIKKFSAMHEFQNLHSM
YKARIQEFIRGHFYGHLDFDLDKTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHKTD
VTVIVFFIMPAKTNNFNVETLKGQAVRKQLWDTAQSVKEKFGRKLYNALLKGEIPDLNKI
LDRDDISIMKRAIFSTQRHSLPPVTTHNMIDDSNDPILNTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPEAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQNRRQRIIQRNRTERLSDLLDWK
YLGRYYMHARHLALSRTFPDKFEMEPSAPPKTEGFRYPRPSSVPPSPSASQHSSPHHSEA
EDDDEDERYDEDEEAERDRQNIKSPFSLGALPQGKKKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgccactggcaagatccctgtccatgacatctctgaatgggcttcttcagtgtgaggat
gaagacctgcccgtggaggatttgttgctctttgaaatttcttgggaagttaccaacaaa
gtgggaggcatttacactgtgatccagacaaaagccaaaactacagcagatgaatgggga
gaaaattatttcctcattggcccctattttgagcagaatgtgaaaactcaggtggaattc
tctgaacctccaaaccctgcagttaagaaggcaatggacgccatgaaaagccaagggtgt
caggtcttttttggaagatggctgatagagggcagcccatatgtcttactctttgatata
ggatcagcagcttggaacctggacaagtggaaaggtggattttgggaggtcagcaacata
gggataccttttcatgaccgagaagccaacgatgctgtgatttttggatcattaacagcc
tggtttttgaaagagctttcctgtcagtttgatgacaagcccaatataattgcccacttc
cacgagtggcaggcaggagtgggtttaatcctgtctcgatcacagaaacttcctgttgcc
acaatttttactacccatgcaactctgcttgggagatacttgtgtgcagccagtattgac
ttttacaacaatctggaccagtttgacattgacaaggaggctggagagaggcagatttac
catcggtactgtatggaacgggcatctgtgcattgtgcccatgtgttcaccacagtctcc
cagatcacagctacagaagcagaacatatgcttaaaaaatgccctgatgttgtcacccca
aatggcttgaacattaagaaattttcagcaatgcatgagtttcagaatttgcattccatg
tacaaggctaggatccaagagttcattcgaggtcatttctatggccaccttgacttcgat
cttgacaagactttgtttttcttcattgctgggagatatgagttttccaacaaaggagct
gatatgtttctagaagccttatcaagattaaactttttgctgagggttcacaagactgac
gttacagttattgtgttcttcatcatgccagcaaagaccaacaatttcaacgtggaaacc
ttgaaaggacaagcagtccggaagcagctctgggacactgcacaatctgtgaaagaaaag
tttggaaggaaactctacaatgccttgctgaaaggagaaatcccagacttgaacaagatt
cttgaccgagatgacataagcattatgaaaagagccatcttttcaactcagagacactct
ctgcctccagtgaccacccacaacatgattgatgacagcaacgacccaatcctcaacacc
atccggcgcattgggctgttcaataaccgcacagaccgcgtgaaggtcatcctacatcca
gagtttctttcttcaacaagtcccttgctgcccctggactatgaggagtttgttagaggc
tgccaccttggtgtattcccatcttactatgaaccctggggctacactccagctgagtgt
actgtgatgggcattcccagtgtaaccacaaacctctctggattcggctgtttcatgcag
gaacatgttgctgacccagaagcttatgggatctacatcgtggacaggaggttccgctcg
ccggacgagtcgtgcaaccagctgacccagttcctgtacgggttctgccagcagaaccgg
cgccagaggatcatccagaggaaccgcaccgagcgcctctccgacctcctggactggaag
tacctgggcaggtattacatgcatgccagacacttggccctcagcagaacattcccagat
aaatttgagatggaaccaagtgctccaccaaagacagaaggtttcaggtaccccaggcct
tcatcggtgccgccgtcgccctcggcctcccagcattccagccctcaccacagcgaagcc
gaggacgacgatgaggatgagagatatgatgaggatgaggaggctgaaagggacaggcag
aacatcaagtcccccttttcccttggagccttgcctcaaggaaaaaagaagcagcacggg
gaatacaggaactga

DBGET integrated database retrieval system