KEGG   Taeniopygia guttata (zebra finch): 100232712Help
Entry
100232712         CDS       T01082                                 

Gene name
USP14
Definition
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 466 aa AA seqDB search
MVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNLKIKNGMTLLMMGSADALPEEPIARP
IFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPEVKEALKRYGGALRASGEM
ASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGDQGQYLQQDANECWVQ
MMRVLQQKLEGIEGDTIMETDSGATAASSKKKSLIDQFFSIEFETAMKCTEAEEEEVTKG
KENLLQLSCFINQEVKYLFTGLKLRLQEEITKLSPTLQRNALYIKSSKISRLPAYLTIQM
VRFFYKEKESVNAKVLKDVKFPLMLDVYELCTPDLQEKMVSYRSKFKDLEDKKVNQQPKN
SSKSDGAQKEVKYEPFSFPDDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWI
KFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRIEVVEEAAEQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcaaagcccagttatttgcactgaccggagttcagccagctagacagaaggtt
atggttaaaggaggaactctgaaggatgatgactggggaaacctgaaaataaagaatggg
atgaccttactaatgatgggttccgccgatgcgcttccagaagagccaattgctcgtccc
atctttgtggaggacatgacagaggagcagttggcttcggctatggaattgccatgtgga
ttgacaaaccttggcaacacttgctacatgaatgctaccgttcagtgtatccgctcagtg
ccagaagtgaaagaggcccttaaaaggtatggtggtgccttaagagcttcaggagaaatg
gcctctgctcaatacattactgcagctcttagagacttgtttgattccatggataaaact
tcctccagtatcccacctatcattctcctgcagtttttacatatggccttcccacagttt
gcagagaaaggtgatcaaggccagtaccttcaacaggatgccaatgagtgctgggtgcag
atgatgagggtactacagcagaagctggaaggcatagaaggtgatacaattatggagaca
gactctggagctacagcagcatcctctaaaaagaagagtttaattgaccaattcttcagc
attgaatttgaaacagccatgaaatgtacagaagccgaagaagaagaagtaactaaagga
aaggagaatctccttcagcttagctgctttatcaatcaagaagtgaaatacctgtttaca
ggactaaaattgcgtcttcaggaggaaatcaccaaactctctccaacgctgcagagaaat
gcactctatatcaaatcttccaaaattagtcgcttgccagcgtacctgactattcagatg
gttagatttttttacaaagagaaagaatctgtgaatgcaaaagttcttaaggatgtcaaa
tttcctcttatgttggatgtatatgagctgtgtacaccagacctgcaggaaaaaatggtt
tcttaccgatcaaaattcaaagatctagaagacaaaaaagtaaatcaacagccaaagaac
tctagtaaaagtgatggtgcacagaaagaagttaaatacgaaccattttcttttcctgat
gatattggttctaacaattgcggctattatgacctgcaggcagtgctaactcatcaaggc
agatcaagttcctctgggcattatgtgtcttgggttaaaaggaaacaagatgaatggatt
aaatttgatgatgacaaagtcagcattgttacacctgaagacattttgaggttatctggg
ggtggagactggcatatagcttatgttctactctatgggcctcgcagaattgaagtcgtt
gaagaagcagctgaacaatag

DBGET integrated database retrieval system