KEGG   Taeniopygia guttata (zebra finch): 100232763Help
Entry
100232763         CDS       T01082                                 

Gene name
GK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tgu00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:tgu03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 741 aa AA seqDB search
MPAEALTNKKMKELGKISCKAFPSGSNQILLIKEQLQQNTPSLDSYYSGGYSGLAPPQRG
PASESVGILSPLRDNKRDTFPEGKPLPGTSDPKGVPLLSRRAGAPLRLPGAPLNRSEIRS
GLRSDRPGLPSDRPELPSGLPSDRPGLRSGLRSGLPSDRPELPSGLPSDQVLGSGANGQL
NHCLISSVFNAETAELLSHHQVELKQEFPREGWVEQDPMEILNSVYECVEKTCEKMNELN
INIANIRAIGVTNQRETTVVWDKTTGEPLYNAIVWLDLRTQSTVERLLKRIPGKNKTFSK
FKTGLPLSTYFSAVKLRWLLDNVEEIKKAVEDGRALFGTIDSWLIWSLTGGKNGGIHCTD
VTNASRTMLFNIHSLEWDPDLCKFFDIPMEILPTVRSSSEIYGVMKICPSRDSGALTGVP
ISGCLGDQHAALVGQMCFKDGQAKNTYGTGCFLLCNTGQKSVFSEHGLITTIAYKMGRDN
PAFYALEGSVAIAGAVVRWLRDNLGIAKTAEEVEKLAEDVGTSYGCYFVPAFSGLYAPYW
EPSARGIICGLTQFTNKNHIAFAALEAVCFQTREILDAMNKDCGIPLNQLQVDGGMTNNK
ILMQLQSDILCIPVVKPSMTETTALGAAMAAGAAKGIEVWSLDPGDLTAVTCERFEPQIN
PEESEYRYARWKKAVMKSMGWESSGGPANGKPKINAGDSSIFSSLPFSIFVMGSMLMLIG
AKYLSAKMVLFVVHAHKRLRV
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgaagcactaacaaacaaaaaaatgaaagagctgggtaagatatcttgcaaa
gctttcccaagtggcagcaatcagattttgcttatcaaggagcagttgcagcaaaacacc
ccaagtttggacagctactacagtggaggatactcaggcttggcacctccccagcggggt
cccgcctcagagagcgtggggattctttcccctctccgcgataacaagcgagacacgttt
cctgaaggaaagccgcttccaggcacaagtgacccaaaaggggtcccgctgctctcccgg
agagccggggctcccctcagactgcccggggctcccctcaaccgctccgagatccgctcg
gggctccgctcagaccgtccggggctcccctcagaccgcccggagctcccctcggggctc
ccctcagaccgcccggggcttcgctcggggctccgctcggggctcccctcagaccgcccg
gagctcccctcggggctcccctcagaccaagtcttaggatcaggagctaatggccagctg
aaccactgtttgatctcttcggtttttaatgcagaaacagcagagctcttgagtcaccat
caagtggaattaaagcaagaattccctagagaaggatgggtggaacaagatccaatggaa
atattaaactctgtctatgaatgtgtggaaaagacctgtgagaaaatgaatgaactgaac
ataaacatcgctaacataagagccattggagtcaccaatcagagagaaacaacagtggtt
tgggacaagacaactggagaacctctttataatgctattgtgtggcttgacctgagaacc
cagtcaacagttgaacgtcttcttaaaagaattccaggaaaaaacaaaactttttctaag
tttaagactggtcttccacttagcacttatttcagtgcagtcaaacttcggtggcttttg
gataacgtggaagagattaagaaagcagttgaggatggaagagctttgtttgggactatt
gattcatggcttatatggagtttgacaggtggaaagaatggaggcattcactgtacagat
gtcaccaatgccagtagaacgatgttgttcaacattcattccttggaatgggatcctgac
ctctgcaagttctttgatattcctatggaaatacttccaaccgtacgaagctcctctgag
atttatggtgtgatgaaaatctgtcctagccgggactctggagctttgacaggtgtacca
atttctgggtgcttgggtgaccagcatgctgctcttgttgggcaaatgtgttttaaagat
ggacaagcaaaaaacacgtacggaacaggttgtttcttgctgtgcaacacaggtcagaag
tctgtgttttctgagcatggtcttataaccacaatagcttacaaaatgggcagagacaac
cctgctttttatgcactagagggatctgttgcaatagctggggctgttgttcgctggctg
agggacaatctgggcattgctaagactgcagaggaagttgaaaaactggctgaagatgtg
ggaacttcctatggctgctactttgtgccagcattttcaggactgtatgcaccatactgg
gaacccagtgcgaggggtatcatctgtggccttactcagtttacaaataaaaaccacatc
gccttcgctgcactagaagcagtctgctttcaaacacgagagattctagatgccatgaac
aaggactgtgggattccactaaatcagttacaagtagatggaggaatgaccaataacaaa
atcctcatgcaactccaatcagacattctctgtattccagtagtaaagccatcaatgact
gaaacaacagctttaggagctgctatggcagcaggagctgcaaaaggtattgaagtttgg
agtctggatcctggagatttgacagcagtgacatgtgaacgatttgaaccacagataaac
ccagaggaaagtgaatatcgctatgccaggtggaagaaagctgtgatgaagtctatggga
tgggagtcatctggcggtcctgcaaatggtaaaccaaaaattaatgcaggtgacagtagt
atcttctctagtctgcctttcagtatttttgttatgggtagcatgctaatgttaattgga
gcaaagtacctctcagcaaaaatggtgctttttgttgttcatgcacacaaacgtttgagg
gtgtga

DBGET integrated database retrieval system