KEGG   Taeniopygia guttata (zebra finch): 101234078Help
Entry
101234078         CDS       T01082                                 

Gene name
PDIA3
Definition
protein disulfide isomerase family A, member 3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101234078 (PDIA3)
Enzymes [BR:tgu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101234078 (PDIA3)
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101234078 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   101234078 (PDIA3)
  Exosomal proteins of bladder cancer cells
   101234078 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 604 aa AA seqDB search
MATGKAEASRGFSPQPWGRLVDAAQYWSTRAARHAAKGRWHWESENRGFVRGQPQALAGP
GHGGARWEQAVPGQSWRQAEHPGRDSTDKGASDRRPQQKVQMPTDGVTGTLLPFLLLALG
ARASDVVELSDADFESGLAERPGLVLVEFFAPWCGHCKRLAPEYESAATRLKGIVPLVKV
DCTANSNTCNKYGVSGYPTLKIFRDGEEAGTYDGPRTADGIVSHLKKQAGPASVALGSVA
EFEKFIGDKDASVVGFFGDASGDAYSEFMKAANSLRDNYRFAHTTEEQLVQKYEEDGEGI
VLFRPPRLTNKFEESSIKYPEEKITSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLVA
YYDVDYEKNTKGSNYWRNRVMMIAKKFLDAGHKLSYAVASRKTFGHELSEFGLDSSVGEA
PVVAIRTAKGDKYVMQEEFSRDGKALERFLQDYFDGNLKKYLKSEPVPESNDGPVKVVVA
ENFDEIVNAQDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPS
PYEVRGFPTIYFAPAGKKQSPKKYEGGREVSDFISYLKREATNTPVLQEEEKSKKSKKKV
KEDL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgggaaaggcggaggcgtctcgcgggttctccccgcagccctggggccgactg
gttgatgcggctcaatattggtccacccgagctgcccggcacgctgccaaagggaggtgg
cactgggagagtgagaatcggggttttgtgcgaggacagccccaggccctggcaggaccg
ggacacggtggtgcgaggtgggagcaggcggtgcctggtcaaagctggcggcaagccgag
caccccggcagggacagcacagataaaggagcttccgaccgcagaccccagcagaaggtg
caaatgccgacggatggggttacggggactctgctgccgttcctgctgctcgccctcggc
gctcgcgcttccgacgtggtggagctcagcgatgccgatttcgagagcggcctggctgaa
cgcccggggctggtgctcgtggagttcttcgcgccctggtgtggacactgcaagcgcctg
gcgccggagtacgagtcggccgccacccggctgaaggggatcgttcctctcgtgaaggtt
gactgtacagcaaactccaacacctgtaacaaatatggagttagtggttatcccacgtta
aagatttttcgagatggagaagaggcagggacctatgatgggcccagaacagcagatggg
attgtcagccatctcaagaaacaggcgggacctgcttcggtggctctcggttctgtggct
gagtttgagaagttcattggcgataaagatgcttctgttgtgggcttctttggtgatgca
tctggggatgcttattcggagttcatgaaagcagccaatagcctcagggataactatcgc
tttgcgcacaccactgaggagcagctggtccagaagtacgaggaagatggagaaggtatt
gtcctattccgtcctccacgcctgaccaacaagtttgaggagagctctatcaaatatcca
gaagagaaaatcaccagtggaaagatcaagaaattcatccaggagaacatctttggcatc
tgccctcacatgactgaagacaacaaagacttgatccagggcaaggacttgctggtggca
tactacgacgttgactatgagaagaataccaagggatccaactactggcgcaacagagtt
atgatgattgcaaagaagttcttggatgctggccacaaactgtcttatgctgttgctagt
cgaaaaacctttggccacgagctttctgagtttggtctggacagcagtgtgggtgaggcc
cccgtcgttgccatcagaactgccaaaggagataaatacgtcatgcaagaagagttctcc
cgtgacggaaaggctctggagagattcctgcaagattactttgatggaaacttgaaaaaa
tacctgaaatcagagcccgtccctgaaagcaacgatggccctgtaaaggtggtggtggct
gagaactttgatgaaattgttaatgcacaagacaaagatgtcctgatagagttctatgca
ccatggtgtggccactgcaagaatctggagcccaaatacaaggaattgggggagaagctc
agcaaagatcccaatatcgtaattgccaaaatggacgctacagccaatgatgtgccttct
ccctatgaagtccgaggtttccccaccatctattttgctccagctggcaagaagcagagt
ccaaagaagtatgaggggggcagagaagtgagtgacttcatcagctacctgaagcgggag
gcaaccaacactcctgtgctgcaggaggaagagaaatccaagaaatccaagaagaaggtg
aaggaggatttgtaa

DBGET integrated database retrieval system