KEGG   Taeniopygia guttata (zebra finch): 101234078Help
Entry
101234078         CDS       T01082                                 

Gene name
PDIA3
Definition
protein disulfide isomerase family A, member 3
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tgu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 604 aa AA seqDB search
MATGKAEASRGFSPQPWGRLVDAAQYWSTRAARHAAKGRWHWESENRGFVRGQPQALAGP
GHGGARWEQAVPGQSWRQAEHPGRDSTDKGASDRRPQQKVQMPTDGVTGTLLPFLLLALG
ARASDVVELSDADFESGLAERPGLVLVEFFAPWCGHCKRLAPEYESAATRLKGIVPLVKV
DCTANSNTCNKYGVSGYPTLKIFRDGEEAGTYDGPRTADGIVSHLKKQAGPASVALGSVA
EFEKFIGDKDASVVGFFGDASGDAYSEFMKAANSLRDNYRFAHTTEEQLVQKYEEDGEGI
VLFRPPRLTNKFEESSIKYPEEKITSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLVA
YYDVDYEKNTKGSNYWRNRVMMIAKKFLDAGHKLSYAVASRKTFGHELSEFGLDSSVGEA
PVVAIRTAKGDKYVMQEEFSRDGKALERFLQDYFDGNLKKYLKSEPVPESNDGPVKVVVA
ENFDEIVNAQDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVPS
PYEVRGFPTIYFAPAGKKQSPKKYEGGREVSDFISYLKREATNTPVLQEEEKSKKSKKKV
KEDL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgggaaaggcggaggcgtctcgcgggttctccccgcagccctggggccgactg
gttgatgcggctcaatattggtccacccgagctgcccggcacgctgccaaagggaggtgg
cactgggagagtgagaatcggggttttgtgcgaggacagccccaggccctggcaggaccg
ggacacggtggtgcgaggtgggagcaggcggtgcctggtcaaagctggcggcaagccgag
caccccggcagggacagcacagataaaggagcttccgaccgcagaccccagcagaaggtg
caaatgccgacggatggggttacggggactctgctgccgttcctgctgctcgccctcggc
gctcgcgcttccgacgtggtggagctcagcgatgccgatttcgagagcggcctggctgaa
cgcccggggctggtgctcgtggagttcttcgcgccctggtgtggacactgcaagcgcctg
gcgccggagtacgagtcggccgccacccggctgaaggggatcgttcctctcgtgaaggtt
gactgtacagcaaactccaacacctgtaacaaatatggagttagtggttatcccacgtta
aagatttttcgagatggagaagaggcagggacctatgatgggcccagaacagcagatggg
attgtcagccatctcaagaaacaggcgggacctgcttcggtggctctcggttctgtggct
gagtttgagaagttcattggcgataaagatgcttctgttgtgggcttctttggtgatgca
tctggggatgcttattcggagttcatgaaagcagccaatagcctcagggataactatcgc
tttgcgcacaccactgaggagcagctggtccagaagtacgaggaagatggagaaggtatt
gtcctattccgtcctccacgcctgaccaacaagtttgaggagagctctatcaaatatcca
gaagagaaaatcaccagtggaaagatcaagaaattcatccaggagaacatctttggcatc
tgccctcacatgactgaagacaacaaagacttgatccagggcaaggacttgctggtggca
tactacgacgttgactatgagaagaataccaagggatccaactactggcgcaacagagtt
atgatgattgcaaagaagttcttggatgctggccacaaactgtcttatgctgttgctagt
cgaaaaacctttggccacgagctttctgagtttggtctggacagcagtgtgggtgaggcc
cccgtcgttgccatcagaactgccaaaggagataaatacgtcatgcaagaagagttctcc
cgtgacggaaaggctctggagagattcctgcaagattactttgatggaaacttgaaaaaa
tacctgaaatcagagcccgtccctgaaagcaacgatggccctgtaaaggtggtggtggct
gagaactttgatgaaattgttaatgcacaagacaaagatgtcctgatagagttctatgca
ccatggtgtggccactgcaagaatctggagcccaaatacaaggaattgggggagaagctc
agcaaagatcccaatatcgtaattgccaaaatggacgctacagccaatgatgtgccttct
ccctatgaagtccgaggtttccccaccatctattttgctccagctggcaagaagcagagt
ccaaagaagtatgaggggggcagagaagtgagtgacttcatcagctacctgaagcgggag
gcaaccaacactcctgtgctgcaggaggaagagaaatccaagaaatccaagaagaaggtg
aaggaggatttgtaa

DBGET integrated database retrieval system