KEGG   Taeniopygia guttata (zebra finch): 101234107Help
Entry
101234107         CDS       T01082                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101234107
Peptidases [BR:tgu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101234107
Exosome [BR:tgu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101234107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
5
AA seq 361 aa AA seqDB search
MRRRGGDGDSGDIGDIGDIGRAERRHGPARHGRARRWWLPWLRSLLLAPLLSCAAVPFLI
RLFPSLLTKFVYLNFLAFPFFVDFRRPELLVNNTINLYLTTEPGVTVGIWHTVPSSKGAE
AQGKEQRWYEEALADGHPVIIYLHGNGGTRAASHRVQFLKTMGAADFHILALDYRGYGDS
TGRPSESGFTTDVLALYDWVKARSGNSSVLFWGHSLGTGIATNAARKLQEERGVQVDAVV
LESPYTNIRDAAANIPITKIYRQFPGFEYLILDSMARAGMFFSSDENVKVLDCPLLILHA
EDDGVLPPKLGHKLYETALKAYKDKSKVKFVTFPQKLGLGHDYISFNPELPALVKDFLNM
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcggcggcgcggcggggacggcgacagcggcgacatcggcgacatcggcgacatcggc
cgggcggagcgcaggcacggcccggcccggcacgggcgggcccggcgctggtggctgcca
tggctgcgctccctcctgctggccccgctcctctcctgcgccgccgtgcccttcctcatc
cgcctcttccccagcctgctcaccaaattcgtctacctgaacttcttggccttccctttc
ttcgtggactttcggcggccggagctgctggtgaacaacaccatcaacctgtacctcacc
accgagccgggcgtcacggttggcatctggcacacggtgcccagcagcaaaggggccgag
gcgcagggcaaggagcagcgctggtacgaggaggctctggctgatggtcaccccgtgatc
atctacctgcacggcaatgggggcaccagggctgcgagtcaccgtgtccagttcttgaag
accatgggggctgccgacttccacatcctggctctcgactacagaggctatggggactcc
actggacgcccctcagagagtggcttcaccacagatgtcctggcactctatgactgggtg
aaagcgcggagtggcaacagcagcgtcctcttctggggacactccctggggacagggatt
gccaccaacgcagcgaggaaactgcaggaggagcgaggggtccaggtcgatgctgttgtc
ctggagtctccctacaccaacatccgagacgcagccgccaacatccccatcaccaagatc
taccggcagttcccgggctttgagtacctgatcctggactccatggctcgggctggaatg
ttcttcagcagtgatgagaacgtgaaggtgctggactgccccctcctcatcctgcacgca
gaagatgatggagtcctgcctccaaagctgggacacaagctctacgagacagcactcaaa
gcctacaaggacaaatccaaggtgaagttcgttacctttccccaaaagctgggcttgggc
cacgattacatctccttcaacccggagctgcctgccctggtgaaagacttcttaaacatg
aagtga

DBGET integrated database retrieval system