KEGG   Taeniopygia guttata (zebra finch): 751584Help
Entry
751584            CDS       T01082                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    751584 (BDNF)
Cytokines [BR:tgu04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    751584 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 246 aa AA seqDB search
MTILFFTMVISYFTCMKAAPMKEASLRGQGSLAYPGLRTHGTIESINGPSASSRGLTSLA
DTFEHVIEELLDEEQDIQPSEGNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAAN
MSMRVRRHSDPARRGELSVCDSTSEWVTAAEKKTAVDMSGATVTVLEKVPVPKGQLKQYF
YETKCNPKGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDNKKRVGWRFIRIDTSCVCTL
TIKRGR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttctttactatggttatctcatacttcacttgcatgaaagctgcccca
atgaaagaagccagtctaagaggacaaggcagcttggcttacccaggtcttcggacccac
gggactattgagagcataaatgggcccagtgccagttcaaggggactgacatcgttggca
gacacttttgaacatgtcatagaggagcttctagacgaggagcaggacatccagcccagt
gagggaaacaaggatgcagacttgtacacatcccgagtcatgctaagcagtcaagtgcct
ttggaacccccactgctcttcctgctcgaggagtacaaaaactacctggatgctgcaaac
atgtccatgcgggtccggcgccactccgacccggctcgccgtggggaactgagcgtgtgt
gacagcacgagcgagtgggtgacagcagcagagaaaaagactgcagtggacatgtccggg
gccaccgtcaccgtcctggagaaagttccagtacccaaaggccagctgaagcaatacttc
tatgagaccaaatgcaaccccaaggggtacacaaaggagggctgcaggggcatagacaag
aggcactggaactcgcagtgccgaactacccagtcttacgtgagagctctcaccatggat
aacaaaaagagagttggctggcgcttcataaggatagacacttcttgtgtatgtacattg
accattaaaaggggaagatag

DBGET integrated database retrieval system