KEGG   Taeniopygia guttata (zebra finch): 751585Help
Entry
751585            CDS       T01082                                 

Gene name
CREB1
Definition
cAMP responsive element binding protein 1
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Adrenergic signaling in cardiomyocytes
Melanogenesis
Class
Organismal Systems; Endocrine system; Melanogenesis [PATH:tgu04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:tgu04261]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 327 aa AA seqDB search
MTMESGAENQQSGDAAGTEAETQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETAAPAIATVTVPTPIYQTSSGQYIAITQGGAIQLS
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagccggtacagaggca
gaaacccaacagatgacagtacaggcacaaccacagattgcaacgttagcccaggtatct
atgccagcagctcacgccacatcttctgcacccacggtgaccttagttcagctgcccaat
gggcagacggttcaagtgcatggagtaattcaggctgcccagccatcagttattcagtct
ccacaggtccagacagttcagatctccactatagcagaaagtgaagattcacaggaatca
gtagacagtgtcacagactcacaaaaacgaagagaaattctgtccagacgaccctcctac
agaaaaattttgaatgacttgtcctcagacgctccaggagtgccaaggatcgaagaagaa
aagtctgaagaggaaacagcagcacctgccatcgccactgttacggtgccaactcccatt
taccaaaccagcagtgggcagtacattgccatcacccaaggaggagcaatacagttgtct
aacaatggcacagatggagtacaaggtctccagacgttgacgatgaccaatgcagctgca
acccaacctggcaccaccattttacaatatgcacagaccacagacggacagcagatactt
gtacccagcaaccaagttgttgtacaagctgcctcaggagacgtgcagacctaccagatc
cgtacggccccgaccagcaccatcgcgccaggcgtagtcatggcgtcctccccagcgctg
ccgacgcagccggcagaggaggctgcgcgcaagagggaagtgcggctgatgaagaacagg
gaggcagcacgtgaatgtcgcaggaagaaaaaggagtacgtgaaatgtctagaaaatcga
gtggctgtgcttgaaaaccaaaacaagacactgattgaggagttaaaagcacttaaagac
ctttactgccacaaatcagattaa

DBGET integrated database retrieval system