KEGG   Taeniopygia guttata (zebra finch): 751589Help
Entry
751589            CDS       T01082                                 

Gene name
UCHL1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase) (EC:3.4.19.12)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     751589 (UCHL1)
Peptidases [BR:tgu01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   751589 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 224 aa AA seqDB search
MAWQPMEINPEMLNKVLSRLGVGPGWRFVDVLGFEDEALRAVPTPACALLLLFPLTEQHE
NFRKQQTEKIKDQEISSKVYFLKQTVSNSCGTIGLIHAVANNKDKLKLEEGSALKKFLDE
TADLSPEERAKHLANNKAIQEVHNSVAQEGQCRVEDNSVNFHFILFVNVDGHLYELDGRM
PFPVNHGTSSDDLLLKDSAKICRQFTEREKGEVRFSAVAFCKST
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcagccgatggagatcaaccccgagatgctgaacaaagtgctgtcccgcctc
ggggtgggtcctggctggcgcttcgtggacgtactgggcttcgaggatgaggcactgcgc
gccgtgccgaccccggcctgcgcgctgctgctgctgttcccgctgactgagcagcatgaa
aacttcaggaagcaacagactgagaaaataaaggaccaagagatcagttctaaagtgtat
ttcctgaagcagaccgtcagtaactcctgtgggacaattggtctgatacatgcagttgct
aataacaaagacaaattgaaacttgaggaggggtctgccctgaagaagtttcttgatgaa
acagctgatttgtctcctgaagagagagctaagcatttggcaaataataaggctatacaa
gaagtccacaattctgttgcgcaagaaggacaatgtcgggttgaggacaacagtgtgaac
ttccatttcatcctttttgtcaacgtggatggacacctgtatgaattggatggccgtatg
ccatttcctgtaaaccatggcacaagctcggatgacttgctgttgaaggattctgctaag
atctgcagacaatttacagagcgtgaaaaaggagaagttcgtttttctgctgtggctttc
tgcaagtctacctaa

DBGET integrated database retrieval system