KEGG   Taeniopygia guttata (zebra finch): 751777Help
Entry
751777            CDS       T01082                                 

Gene name
CYP19A1, CYPXIX, P-450AROM
Definition
cytochrome P450, family 19, subfamily A, polypeptide 1 (EC:1.14.14.14)
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    751777 (CYP19A1)
Enzymes [BR:tgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     751777 (CYP19A1)
Cytochrome P450 [BR:tgu00199]
 Cytochrome P450, animal type
  CYP19 family
   751777 (CYP19A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 509 aa AA seqDB search
MVLETLNPLHYNITSLVPDTMPVATVPILILMCFLFLIWNHEETSSIPGPGYCMGIGPLI
SHGRFLWMGVGNACNYYNKTYGDFVRVWISGEETFIISKSSSVSHVMKHWHYVSRFGSKL
GLQCIGMYENGIIFNNNPAHWKEIRPFFTKALSGPGLVRMIAICVESTTEHLDRLQEVTT
ELGNINALNLMRRIMLDTSNKLFLGVPLDENAIVLKIQNYFDAWQALLLKPDIFFKISWL
CKKYKDAVKDLKGAMEILIEQKRQKLSTVEKLDEHMDFASQLIFAQNRGDLTAENVNQCV
LEMMIAAPDTLSVTLFFMLILIAEHPTVEEEMMREIETVVGDRDIQSDDMPNLKIVENFI
YESMRYQPVVDLIMRKALQDDVIDGYPVKKGTNIILNIGRMHKLEFFPKPNEFSLENFEK
NVPSRYFQPFGFGPRSCVGKFIAMVMMKAILVTLLRRCRVQTMKGRGLNNIQKNNDLSMH
PIERQPLLEMVFTPRRNANENQGDGMDQH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtcctggaaaccctgaacccgctgcactacaacatcaccagcctggtaccagacacg
atgcccgtggccacggtgcccatactcatcctcatgtgcttcctctttctgatatggaat
cacgaagagacttcatcaataccagggccaggatactgcatgggcatcggccccctcatc
tcacacgggagatttctctggatgggagtagggaacgcctgcaactactacaataagaca
tatggagactttgtgagagtttggatcagcggtgaagaaacatttataattagcaaatcc
tcaagtgtgtcccatgtaatgaagcactggcattacgtgtctcgatttgggagtaagctt
ggattacagtgcattggcatgtacgagaatgggatcatatttaacaacaacccagcacac
tggaaagaaattcgaccctttttcaccaaagctctgtctggccccgggctggtgcggatg
atcgcgatttgcgtggagtcgaccaccgagcacctggacaggctgcaggaggtcaccacg
gagctgggcaacatcaacgcgctcaacctcatgaggcggatcatgctcgacacgtccaac
aagctcttcctcggggtccctctggatgaaaatgccattgtgcttaagattcagaactac
tttgatgcgtggcaagcacttttattaaagcctgacatattttttaaaatttcttggctg
tgcaagaagtacaaagatgcagtcaaggatcttaaaggagcaatggaaattttaatagaa
cagaaacgacaaaagctttccactgtcgaaaagctggatgagcacatggattttgcatcc
cagttgatttttgcacagaacagaggggatctgactgctgagaatgtgaaccagtgtgtg
ctggagatgatgattgctgctcctgacactctgtctgtgactctcttctttatgttaatc
ctgattgcagagcaccccacagtggaagaggagatgatgagagaaattgaaactgttgtg
ggcgacagagacatacaaagtgatgacatgccaaacttaaaaattgtggagaattttatt
tatgagagcatgagataccagccagttgtggacttgatcatgaggaaagcgttacaggat
gatgtcattgatggctaccctgtgaaaaagggcacaaatatcatcctcaatatcggccgt
atgcacaaactcgaattcttcccaaagccaaacgagttttctcttgaaaattttgagaaa
aatgttccttcccgctatttccagccctttgggttcggcccccggagctgtgtggggaag
ttcattgccatggtcatgatgaaggcgatcctagtgactcttctgaggcgctgcagagtg
cagactatgaaaggaagaggcctgaacaacatccagaaaaacaatgacttatccatgcac
cccatagaaaggcagcctctgctggagatggtttttacacccagaagaaatgcaaacgag
aatcagggtgatggaatggatcagcactaa

DBGET integrated database retrieval system