KEGG   Taeniopygia guttata (zebra finch): 751954Help
Entry
751954            CDS       T01082                                 

Gene name
GRIA4
Definition
(RefSeq) glutamate receptor, ionotropic, AMPA 4
  KO
K05200  
glutamate receptor 4
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    751954 (GRIA4)
Ion channels [BR:tgu04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   751954 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 433 aa AA seqDB search
MRIICRQLVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNRFVFLYDTDRGYSILQAIMEKAGQNSWQ
VSAICVENFNDASYRRLLEDLDRRQEKKFVIDCEIERLQNLLEQIVSVGKHVKGYHYIVA
NLGFKDISLERFMHGGANVTGFQLVDFSTPMVTKLMQRWKKLDQREYPGSEMPPKYTSAL
TYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKNTGPRKVGYWNDMDKLVLIQHEPTLGNDTAAIENRTVVVT
TILPLMKNPILRN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaggataatttgcagacagcttgtcttgttgttttctggcttttggggactagcaatg
ggagcttttcctagcagcgtgcaaataggtggtctcttcatcaggaacacagatcaggaa
tacactgcttttcgattagcgatctttcttcataacaccagccccaatgcatccgaagca
ccttttaatttggttcctcatgtagacaacattgaaacagctaacagcttcgctgtaaca
aatgccttttgctcccagtattctagaggagtttttgccatttttggactatatgataag
agatcagtacataccttgacctcattctgcagcgccttgcacatctccctcatcacgccg
agtttccccacggagggcgagagccagttcgtgctgcagctgcggccgtccctgcgggga
gccctcctgagcttgctggatcattatgaatggaaccgctttgttttcctgtatgacaca
gatcgaggttattcaatacttcaagcaattatggaaaaagcaggacaaaatagctggcaa
gtcagtgccatctgtgtggagaattttaatgatgccagctacaggcggcttttagaagat
ctggaccgaaggcaagaaaagaaatttgtaatagactgtgaaatagagaggcttcagaat
ctcttagaacagatcgtgagcgtgggaaagcatgttaaaggctaccattatattgttgcc
aacctgggattcaaagatatttctctggagagatttatgcatgggggagccaatgtgact
ggatttcagctggtggatttcagtaccccaatggtaactaagctgatgcagcgctggaaa
aaactggaccagagagaatacccaggatctgagatgccaccaaagtatacatctgcattg
acatatgatggagtacttgtgatggctgaaactttccgtaatcttagaagacagaaaatt
gatatttcaaggagaggaaatgctggtgattgtcttgccaaccctgcagccccatggggt
caaggaattgatatggagaggacattaaaacaggttcgaatacaaggtttgactggaaat
gttcagttcgaccactacggtcgcagagtcaactacaccatggatgtctttgagctgaaa
aatactggccctcggaaggttggttactggaatgatatggataaattagttttgattcag
catgaacctacacttggaaatgacactgcagctattgagaatagaacagtagttgtcact
acaattttgcctctgatgaagaatcctattttaagaaattga

DBGET integrated database retrieval system