KEGG   Taeniopygia guttata (zebra finch): 778446Help
Entry
778446            CDS       T01082                                 

Gene name
RARB
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
tgu  Taeniopygia guttata (zebra finch)
Brite
Transcription factors [BR:tgu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    778446 (RARB)
Nuclear receptors [BR:tgu03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   778446 (RARB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 448 aa AA seqDB search
MFDCMDVLAVSPAQMLDFYTASPSSCMLQEKALKACFSGLAQTEWQHRHSAQSVETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQESTENYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPMKVDKLQEPLLEALKIYIRKRR
PNKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPTS
NGNTAENSPSISPSSVDNSSVSQSPMVD
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgtatggacgttctagcagtgagccctgctcagatgctggatttctacact
gcgagtccgtcttcctgcatgctccaggagaaggctctcaaagcatgcttcagtggattg
gcacaaacagagtggcaacaccggcacagtgctcaatcagttgaaactcagagcaccagt
tctgaggaacttgttccgagccctccttcaccacttccaccccctcgtgtttacaagccc
tgttttgtttgtcaagacaagtcatctggatatcactatggtgtcagtgcttgtgaggga
tgtaagggctttttccgcaggagtatccagaagaacatggtttacacatgtcacagagat
aaaaactgtgttatcaataaagttaccagaaatcgctgccagtactgtagactacagaag
tgctttgaagtgggaatgtccaaagaatctgtcagaaacgacaggaacaaaaagaagaag
gaaccttcaaagcaagagtccacagaaaactatgaaatgacagcagagttagatgatctc
actgagaagatccgaaaagctcaccaggaaaccttcccctcgctctgccagctgggaaaa
tacactacgaactccagcgcagatcatcgagttcgactggaccttggactctgggacaaa
ttcagtgaacttgcaacgaagtgcattattaaaatagtggaatttgcaaaacgattgcca
ggctttacaagtttgaccattgcagaccaaataactctactgaaagcagcctgcctggat
atactgatccttagaatttgcacaagatacacaccagaacaagacaccatgaccttttca
gatggccttaccctaaaccgaactcagatgcacaatgccggatttggcccgctgactgat
ctcgtgttcacatttgccaaccagctcctgcctttggaaatggatgacacagaaacaggt
ctccttagtgccatctgcctaatctgtggagatcgccaggaccttgaagaaccaatgaaa
gtggataagcttcaggaacccttgcttgaagcactgaaaatttatatccgaaagagacga
cccaacaagcctcatatgttcccaaagatcttaatgaaaatcacggatcttcgtagcatc
agtgcaaaaggtgcagaacgtgttattacattgaaaatggaaattcctggatccatgcca
cctcttattcaggaaatgttggagaactctgaaggacatgaaccactgacaccaacctca
aatggaaatactgcagaaaacagtcccagtatctcacctagttcagtggataacagcagt
gtcagtcaatcccctatggtggactaa

DBGET integrated database retrieval system