KEGG   Taeniopygia guttata (zebra finch): 778446Help
Entry
778446            CDS       T01082                                 

Gene name
RARB
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
tgu  Taeniopygia guttata (zebra finch)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 448 aa AA seqDB search
MFDCMDVLAVSPAQMLDFYTASPSSCMLQEKALKACFSGLAQTEWQHRHSAQSVETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQESTENYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPMKVDKLQEPLLEALKIYIRKRR
PNKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPTS
NGNTAENSPSISPSSVDNSSVSQSPMVD
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgtatggacgttctagcagtgagccctgctcagatgctggatttctacact
gcgagtccgtcttcctgcatgctccaggagaaggctctcaaagcatgcttcagtggattg
gcacaaacagagtggcaacaccggcacagtgctcaatcagttgaaactcagagcaccagt
tctgaggaacttgttccgagccctccttcaccacttccaccccctcgtgtttacaagccc
tgttttgtttgtcaagacaagtcatctggatatcactatggtgtcagtgcttgtgaggga
tgtaagggctttttccgcaggagtatccagaagaacatggtttacacatgtcacagagat
aaaaactgtgttatcaataaagttaccagaaatcgctgccagtactgtagactacagaag
tgctttgaagtgggaatgtccaaagaatctgtcagaaacgacaggaacaaaaagaagaag
gaaccttcaaagcaagagtccacagaaaactatgaaatgacagcagagttagatgatctc
actgagaagatccgaaaagctcaccaggaaaccttcccctcgctctgccagctgggaaaa
tacactacgaactccagcgcagatcatcgagttcgactggaccttggactctgggacaaa
ttcagtgaacttgcaacgaagtgcattattaaaatagtggaatttgcaaaacgattgcca
ggctttacaagtttgaccattgcagaccaaataactctactgaaagcagcctgcctggat
atactgatccttagaatttgcacaagatacacaccagaacaagacaccatgaccttttca
gatggccttaccctaaaccgaactcagatgcacaatgccggatttggcccgctgactgat
ctcgtgttcacatttgccaaccagctcctgcctttggaaatggatgacacagaaacaggt
ctccttagtgccatctgcctaatctgtggagatcgccaggaccttgaagaaccaatgaaa
gtggataagcttcaggaacccttgcttgaagcactgaaaatttatatccgaaagagacga
cccaacaagcctcatatgttcccaaagatcttaatgaaaatcacggatcttcgtagcatc
agtgcaaaaggtgcagaacgtgttattacattgaaaatggaaattcctggatccatgcca
cctcttattcaggaaatgttggagaactctgaaggacatgaaccactgacaccaacctca
aatggaaatactgcagaaaacagtcccagtatctcacctagttcagtggataacagcagt
gtcagtcaatcccctatggtggactaa

DBGET integrated database retrieval system