KEGG   Thermococcus sp. AM4: TAM4_1107Help
Entry
TAM4_1107         CDS       T01638                                 

Definition
(GenBank) Ketoisovalerate oxidoreductase subunit VorG
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tha  Thermococcus sp. AM4
Pathway
tha00010  Glycolysis / Gluconeogenesis
tha00020  Citrate cycle (TCA cycle)
tha00620  Pyruvate metabolism
tha00633  Nitrotoluene degradation
tha00640  Propanoate metabolism
tha00650  Butanoate metabolism
tha00680  Methane metabolism
tha00720  Carbon fixation pathways in prokaryotes
tha01100  Metabolic pathways
tha01120  Microbial metabolism in diverse environments
tha01130  Biosynthesis of antibiotics
tha01200  Carbon metabolism
Module
tha_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TAM4_1107
   00020 Citrate cycle (TCA cycle)
    TAM4_1107
   00620 Pyruvate metabolism
    TAM4_1107
   00640 Propanoate metabolism
    TAM4_1107
   00650 Butanoate metabolism
    TAM4_1107
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TAM4_1107
   00680 Methane metabolism
    TAM4_1107
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TAM4_1107
Enzymes [BR:tha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TAM4_1107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: EEB73359
UniProt: B7R3Y6
Position
complement(1661680..1662237)
Genome map
AA seq 185 aa AA seqDB search
MIEIRFHGRGGQGAVTAANILASAAFKEGKYVQAFPFFGVERRGAPVTAFTRIDDKPIRI
KTQIYEPDIVVVLDPSLLDTVDVTAGLKDGGTVIINTEKSKEEVLEKLKKKPGKLALVDA
TGIALEVLGLPITNTAILGAVAKATGIVKLESVQEAIKETFSGALGEKNAKAAEEAFNKT
TVYEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagatacgttttcacggtaggggtggacagggtgcagttacagccgcgaacatc
ttagcctctgcggccttcaaggagggaaaatacgtccaggcgttccccttcttcggtgtt
gagaggcgtggagcaccggttacagctttcacaaggatagacgacaagccgataagaata
aagacccagatctacgagccggacatagtggtcgtcctcgacccgagccttctggacacc
gttgacgtcacggccggcctcaaggacggcgggaccgtcatcataaacaccgagaagagc
aaggaggaagtcctcgagaagctcaagaagaagccgggcaagctggccctggtggatgca
acgggcatagcccttgaagtcctcggccttccgatcaccaacacggccatccttggagcg
gtcgcgaaggcgaccggaatagtgaagctcgagagcgttcaggaggccatcaaggagacc
ttctccggagccctcggcgagaagaacgccaaggccgccgaggaagccttcaacaagacc
actgtctacgagctctga

DBGET integrated database retrieval system