KEGG   Thermococcus sp. AM4: TAM4_1122Help
Entry
TAM4_1122         CDS       T01638                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tha  Thermococcus sp. AM4
Brite
Enzymes [BR:tha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TAM4_1122
Transfer RNA biogenesis [BR:tha03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TAM4_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1667857..1669629
Genome map
AA seq 590 aa AA seqDB search
MDERFQEAVRELARLVMEGEIKSRDELNRWKIKVARKYHLSKIPGNSDILRAIPEERREE
FRDLLKRKPTRTISGVAVVAMMTKPFPCPHGRCIYCPGGPSVGSPQSYTGREPSALRAIQ
SAYHPYIIMMRRLKQLTDIGHDVDKVEVIIQGGTFPAVDLDYQEWFIKCAFKAMNDFPHF
RDIENLEEKLIRLIVKKDESVFEEDPKFREAWQKTHAKPYYYLEDEQRKNEKAKVRMVGL
TIETRPDWAFERQIDRMLHFGTTRVELGVQTVFNFIHERTKRGHGVEEIVKATQLLRDAG
LKINYHIMPGLPGSNFERDLYTFRTIFEDSRFRPDMLKVYPTLVTKDAPLYRWWKEGKYR
PYRTEEAVDLLVEAYKLFPKWVRVMRIQRDIPVQLIVDGVKHSNLGQLVFNELIKRGIRP
REIRFREVGHMMEKFGIQPEVEHIKLLREDYEASGGREIFLSFEDTKNDILIGFLRLRIP
SEKAHRKEINCCPSAIVRELHVYGPLVPIGGKPRYEWQHRGYGRELLAEAERIAREEFDV
KKMLVISGVGVRNYYRKFGYRKNGPYVAKRLDRGYAEYKKSREFDAHLNT
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggatgagagattccaggaggcagttagagagcttgcgagactcgtgatggagggcgag
attaagagcagggacgagctcaaccgctggaagattaaggtggcgagaaagtatcatctc
tcaaagattccgggcaattccgacattctgagggccattccggaggagaggcgcgaggag
ttcagggacttgctgaagagaaagccaacgaggacgataagcggagtggctgtcgttgct
atgatgacgaagccctttccctgtcctcatggcagatgtatctactgtcccggcgggccg
agcgtcggttcaccccagagctacacgggaagggagccgtcagctttaagggcaatccag
agcgcctaccacccttacatcatcatgatgcgtcgccttaagcagctcaccgacatcggc
cacgacgttgacaaggtcgaggtcataatccagggcggaacctttccggcggttgacctc
gattatcaggagtggttcatcaagtgtgccttcaaggccatgaacgacttcccgcacttt
agagacatagagaacctcgaggagaagctgattaggctgatagtgaagaaggacgagtcc
gtttttgaggaagacccgaagttccgcgaggcgtggcagaaaacgcacgcaaagccctac
tactaccttgaagacgagcagaggaagaacgagaaagctaaggtcagaatggtcggcctt
acgatagagacaaggcccgactgggccttcgagaggcagattgacaggatgctccacttt
ggcaccacgcgcgttgagcttggagtccagacggttttcaacttcatccacgagaggacc
aaacgcggtcacggcgttgaggagatagtaaaggccacacagctcctccgcgatgctgga
ttgaaaatcaactaccacataatgcccggccttcccgggagcaactttgagcgcgaccta
tacaccttcaggacgattttcgaggattctcgcttcaggcccgacatgctaaaggtttac
ccgacgcttgtaaccaaggacgcccccctctaccgctggtggaaggaaggtaaataccgc
ccataccgtacggaagaagccgttgatctcctcgttgaggcatacaagctcttcccgaag
tgggttcgcgttatgagaatccagcgcgacattcccgttcagctcatcgttgacggcgtc
aagcactcgaacctcggccagctcgtcttcaacgagctgataaagcgcggtataaggccg
agggagattcgctttagggaagtcggccacatgatggagaagttcggaatccagccggag
gtcgagcatataaagctcctccgcgaggactacgaggcctctggcgggagggagattttc
ctgagctttgaagataccaagaacgacatcctaatcggcttcctcaggctgagaattccg
agcgaaaaggcccaccggaaggagataaactgctgtccctcggcgatagtcagggaactc
cacgtctacggcccgctcgtgccgattggaggaaagccccgctacgagtggcagcacagg
ggttacggaagggagcttctggccgaggccgagaggattgcccgcgaggagttcgacgtt
aagaagatgctcgtcatcagcggtgtcggcgtcaggaactactaccggaagttcggctac
cggaagaacggcccctacgtcgcgaagaggctcgataggggctacgccgaatacaaaaag
agcagggagttcgacgcgcacctgaacacttaa

DBGET integrated database retrieval system