KEGG   Thermococcus sp. AM4: TAM4_1210Help
Entry
TAM4_1210         CDS       T01638                                 

Definition
fructose-1,6-bisphosphatase type V
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tha  Thermococcus sp. AM4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TAM4_1210
   01230 Biosynthesis of amino acids
    TAM4_1210
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TAM4_1210
   00030 Pentose phosphate pathway
    TAM4_1210
   00051 Fructose and mannose metabolism
    TAM4_1210
  Energy metabolism
   00680 Methane metabolism
    TAM4_1210
Enzymes [BR:tha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TAM4_1210
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TAM4_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1519964..1521091)
Genome map
AA seq 375 aa AA seqDB search
MAVGEKITISVIKADIGGWPGHSRVHPQLIETAEEILAKAKEEGTIIDFYVAYAGDDLQL
IMTHKKGVDSPDVHGLAWKAFEEATKVAKELGLYGAGQDLLKDAFSGNVRGMGPGVAEME
ITLRKSEPIVTFHMDKTEPGAFNLPIFRMFADPFNTAGLVIDPKMHMGFRFEVWDILKHK
RVILNTPEEVYDLLALIGAKSRYVIKRVYPKEGHPIPKDEPVAVVSTEKLYEIAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPIMPVPMNYANPTRFDGPPRV
VALGWQISPEGKLVGPVDLFDDPAYDYARQKALEITEYMRRHGPFEPHRLPLEDMEYTTL
PGVLKRLEERFEDIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccgttggagaaaagataacgatcagtgtaataaaggccgacataggcggctggccg
ggacactcaagggtgcacccgcagctcattgagaccgctgaagagatcctcgccaaggcc
aaggaggagggtacaataatagacttctacgtggcctacgcgggcgacgacctccagctg
ataatgacccacaagaagggcgttgacagccccgacgttcacgggctcgcctggaaggcc
ttcgaggaggcaaccaaggtagctaaggagctcggcctctacggtgccggacaggacctt
ctcaaagatgcattcagcggaaacgtccgcggaatggggcccggtgtggctgagatggag
ataacgctgaggaagagcgagccgatagtgaccttccacatggacaagaccgagcctggc
gcgtttaacctgccgatattcaggatgttcgccgacccgttcaacaccgctggcttagtc
atcgaccccaagatgcacatgggcttccgcttcgaggtctgggacatcctcaagcacaag
cgcgtcatcctcaacaccccggaggaggtctacgaccttctcgcactcatcggtgccaag
agccgctacgtcatcaagcgcgtttatccgaaggagggccacccgattccgaaggacgag
ccggtagctgtcgtcagcaccgagaagctctacgagatcgctggagaatacgtcggcaag
gacgacccggtcgccatagtcagggcccagagcggacttccggcccttggtgaggtcctc
gagcccttcgccttcccgcacctcgtcagcggatggatgcgcggttcccacaacggcccg
ataatgcccgttccgatgaactacgccaacccgacccgctttgacggcccgccgagggtt
gtcgcgctcggctggcagataagccccgaaggaaagctcgtcggtccggttgacctcttc
gacgaccctgcctacgactacgccaggcagaaggcccttgagataaccgagtacatgcgc
aggcacggcccgttcgagccgcacaggctcccgctcgaggacatggagtacaccaccctg
ccgggtgtgctgaagaggcttgaggagcgcttcgaggacatcgagtga

DBGET integrated database retrieval system