KEGG   Thermococcus sp. AM4: TAM4_1210Help
Entry
TAM4_1210         CDS       T01638                                 

Definition
(GenBank) Fructose-1,6-bisphosphatase type V
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tha  Thermococcus sp. AM4
Pathway
tha00010  Glycolysis / Gluconeogenesis
tha00030  Pentose phosphate pathway
tha00051  Fructose and mannose metabolism
tha00680  Methane metabolism
tha01100  Metabolic pathways
tha01110  Biosynthesis of secondary metabolites
tha01120  Microbial metabolism in diverse environments
tha01130  Biosynthesis of antibiotics
tha01200  Carbon metabolism
tha01230  Biosynthesis of amino acids
Module
tha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TAM4_1210
   00030 Pentose phosphate pathway
    TAM4_1210
   00051 Fructose and mannose metabolism
    TAM4_1210
  Energy metabolism
   00680 Methane metabolism
    TAM4_1210
Enzymes [BR:tha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TAM4_1210
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TAM4_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: EEB73462
UniProt: B7R3I6
Position
complement(1519964..1521091)
Genome map
AA seq 375 aa AA seqDB search
MAVGEKITISVIKADIGGWPGHSRVHPQLIETAEEILAKAKEEGTIIDFYVAYAGDDLQL
IMTHKKGVDSPDVHGLAWKAFEEATKVAKELGLYGAGQDLLKDAFSGNVRGMGPGVAEME
ITLRKSEPIVTFHMDKTEPGAFNLPIFRMFADPFNTAGLVIDPKMHMGFRFEVWDILKHK
RVILNTPEEVYDLLALIGAKSRYVIKRVYPKEGHPIPKDEPVAVVSTEKLYEIAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPIMPVPMNYANPTRFDGPPRV
VALGWQISPEGKLVGPVDLFDDPAYDYARQKALEITEYMRRHGPFEPHRLPLEDMEYTTL
PGVLKRLEERFEDIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccgttggagaaaagataacgatcagtgtaataaaggccgacataggcggctggccg
ggacactcaagggtgcacccgcagctcattgagaccgctgaagagatcctcgccaaggcc
aaggaggagggtacaataatagacttctacgtggcctacgcgggcgacgacctccagctg
ataatgacccacaagaagggcgttgacagccccgacgttcacgggctcgcctggaaggcc
ttcgaggaggcaaccaaggtagctaaggagctcggcctctacggtgccggacaggacctt
ctcaaagatgcattcagcggaaacgtccgcggaatggggcccggtgtggctgagatggag
ataacgctgaggaagagcgagccgatagtgaccttccacatggacaagaccgagcctggc
gcgtttaacctgccgatattcaggatgttcgccgacccgttcaacaccgctggcttagtc
atcgaccccaagatgcacatgggcttccgcttcgaggtctgggacatcctcaagcacaag
cgcgtcatcctcaacaccccggaggaggtctacgaccttctcgcactcatcggtgccaag
agccgctacgtcatcaagcgcgtttatccgaaggagggccacccgattccgaaggacgag
ccggtagctgtcgtcagcaccgagaagctctacgagatcgctggagaatacgtcggcaag
gacgacccggtcgccatagtcagggcccagagcggacttccggcccttggtgaggtcctc
gagcccttcgccttcccgcacctcgtcagcggatggatgcgcggttcccacaacggcccg
ataatgcccgttccgatgaactacgccaacccgacccgctttgacggcccgccgagggtt
gtcgcgctcggctggcagataagccccgaaggaaagctcgtcggtccggttgacctcttc
gacgaccctgcctacgactacgccaggcagaaggcccttgagataaccgagtacatgcgc
aggcacggcccgttcgagccgcacaggctcccgctcgaggacatggagtacaccaccctg
ccgggtgtgctgaagaggcttgaggagcgcttcgaggacatcgagtga

DBGET integrated database retrieval system