KEGG   Thermococcus sp. AM4: TAM4_1329Help
Entry
TAM4_1329         CDS       T01638                                 

Definition
ribulose-5-phosphate 4-epimerase-related epimerase/aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tha  Thermococcus sp. AM4
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tha00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1487809..1488366
Genome map
AA seq 185 aa AA seqDB search
MTRIAKRQLVIYSKKAHERGLTAAFGGNLSVRVGNLVFIKATGAVMDEMTEEQVAVIDLK
GNQLSGVRPSSEYRLHLAVYRARPDVRAIAHLHPPYSIVASTLLEGELPIITPEAEIYLG
RIPIAPFRPAGTEELAEVTAEALKGADAVLMAKHGIVTVGKSLREAFYKAELVEESTRLW
YLSRK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaatagcaaaacgccagcttgtcatctactccaaaaaggcccacgagcggggt
ttgacggccgctttcggcggaaacctgagcgtccgcgtcgggaatttggtgttcatcaag
gcgaccggagcggtgatggatgagatgaccgaggagcaggtggcggtgatagacctgaaa
ggaaaccagctctccggcgttaggccctcctccgaataccggctccatctggccgtttac
agggcgaggccggacgttagggcaatagcccacctccacccgccgtactcgatagtcgcc
tcgacactactcgaaggcgaactgccgataataacgcccgaggcggaaatctacctcggg
agaattccgatagcgcccttcagacccgctgggacggaagaacttgcggaagtaacggcg
gaagctttgaagggtgcggacgcggttctgatggcgaagcacggaatcgttaccgttgga
aaaagcctgagggaagctttctacaaggcggagctggttgaggagagcaccaggctctgg
tacctgagcaggaaatga

DBGET integrated database retrieval system