KEGG   Thermococcus sp. AM4: TAM4_1330Help
Entry
TAM4_1330         CDS       T01638                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tha  Thermococcus sp. AM4
Pathway
tha00010  Glycolysis / Gluconeogenesis
tha00051  Fructose and mannose metabolism
tha00562  Inositol phosphate metabolism
tha01100  Metabolic pathways
tha01110  Biosynthesis of secondary metabolites
tha01120  Microbial metabolism in diverse environments
tha01130  Biosynthesis of antibiotics
tha01200  Carbon metabolism
tha01230  Biosynthesis of amino acids
Module
tha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tha_M00002  Glycolysis, core module involving three-carbon compounds
tha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TAM4_1330
   00051 Fructose and mannose metabolism
    TAM4_1330
   00562 Inositol phosphate metabolism
    TAM4_1330
Enzymes [BR:tha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TAM4_1330
Exosome [BR:tha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TAM4_1330
  Exosomal proteins of bladder cancer cells
   TAM4_1330
  Exosomal proteins of melanoma cells
   TAM4_1330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS FMN_dh NMO DHO_dh His_biosynth NanE B12-binding DUF2099 RNA_pol_inhib
Motif
Other DBs
NCBI-ProteinID: EEB73581
UniProt: B7R443
Position
1717197..1717877
Genome map
AA seq 226 aa AA seqDB search
MAKLKEPIIAINFKTYIEATGKRALAIAKAAEKVYKETGITIVVAPQLADLRTIAESVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMT
MVCSNNPAVSAAVAALGPDYVAVEPPELIGTGIPVSKAKPEVITNTVELVKKVNPEVKVL
TGAGISTGEDVKKALELGSVGVLLASGVTKAEDPEKAIRDLVSLIL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagctgaaggagccgattatagcgattaacttcaagacctacatagaggcgacc
ggaaagagggctttggcaatagcgaaagctgccgagaaggtctacaaggagaccgggata
accatagtcgtcgcgccccagctcgcggatttgagaaccatagcggagagcgttgagatc
ccggtttttgcccagcacatcgacccgattaagcccggaagccacaccggccacgtcctt
cccgaggctgtgaaagaggccggagccgttggaacgctcctcaaccactccgagaacagg
atgatcctggcagaccttgaggcggcaataagacgcgccgaggaagtcgggctcatgacg
atggtctgctccaacaaccccgccgtttccgcggcggtcgctgccctcggcccggattac
gttgcggtcgagccgccggagctcatcggcacggggatccccgtgagcaaggccaagccg
gaggtcataaccaacaccgtcgagctcgtgaagaaggtcaacccagaggtcaaggtcctc
accggagcggggataagcacgggtgaagacgtgaaaaaagcgttggaactcggaagcgtc
ggggttctcctcgcgagcggtgttaccaaggctgaggaccccgaaaaggcaataagggat
ctcgtgtccctcatcctctga

DBGET integrated database retrieval system