KEGG   Thermococcus sp. AM4: TAM4_1330Help
Entry
TAM4_1330         CDS       T01638                                 

Definition
(RefSeq) Triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tha  Thermococcus sp. AM4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TAM4_1330
   01230 Biosynthesis of amino acids
    TAM4_1330
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TAM4_1330
   00051 Fructose and mannose metabolism
    TAM4_1330
   00562 Inositol phosphate metabolism
    TAM4_1330
Enzymes [BR:tha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TAM4_1330
Exosome [BR:tha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TAM4_1330
  Exosomal proteins of bladder cancer cells
   TAM4_1330
  Exosomal proteins of melanoma cells
   TAM4_1330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1717197..1717877
Genome map
AA seq 226 aa AA seqDB search
MAKLKEPIIAINFKTYIEATGKRALAIAKAAEKVYKETGITIVVAPQLADLRTIAESVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMT
MVCSNNPAVSAAVAALGPDYVAVEPPELIGTGIPVSKAKPEVITNTVELVKKVNPEVKVL
TGAGISTGEDVKKALELGSVGVLLASGVTKAEDPEKAIRDLVSLIL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagctgaaggagccgattatagcgattaacttcaagacctacatagaggcgacc
ggaaagagggctttggcaatagcgaaagctgccgagaaggtctacaaggagaccgggata
accatagtcgtcgcgccccagctcgcggatttgagaaccatagcggagagcgttgagatc
ccggtttttgcccagcacatcgacccgattaagcccggaagccacaccggccacgtcctt
cccgaggctgtgaaagaggccggagccgttggaacgctcctcaaccactccgagaacagg
atgatcctggcagaccttgaggcggcaataagacgcgccgaggaagtcgggctcatgacg
atggtctgctccaacaaccccgccgtttccgcggcggtcgctgccctcggcccggattac
gttgcggtcgagccgccggagctcatcggcacggggatccccgtgagcaaggccaagccg
gaggtcataaccaacaccgtcgagctcgtgaagaaggtcaacccagaggtcaaggtcctc
accggagcggggataagcacgggtgaagacgtgaaaaaagcgttggaactcggaagcgtc
ggggttctcctcgcgagcggtgttaccaaggctgaggaccccgaaaaggcaataagggat
ctcgtgtccctcatcctctga

DBGET integrated database retrieval system