KEGG   Thermococcus sp. AM4: TAM4_1397Help
Entry
TAM4_1397         CDS       T01638                                 

Definition
pyruvate:ferredoxin oxidoreductase subunit C4811delta subunit
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tha  Thermococcus sp. AM4
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TAM4_1397
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TAM4_1397
   00020 Citrate cycle (TCA cycle)
    TAM4_1397
   00620 Pyruvate metabolism
    TAM4_1397
   00640 Propanoate metabolism
    TAM4_1397
   00650 Butanoate metabolism
    TAM4_1397
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TAM4_1397
   00680 Methane metabolism
    TAM4_1397
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TAM4_1397
Enzymes [BR:tha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TAM4_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1658832..1659149)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERVQKEYSEKMTPGAIAYIPGSSVINKTGSWRVFMPEFNRDKCVRCYLCY
IYCPEPAIYLDEENYPVFDYDYCKGCGICANECPTDAIIMVRETK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagcccgtttaaggccgatattgagagggttcagaaggagtatagcgaaaag
atgaccccgggagcgatagcctacatcccggggagtagcgtgataaacaagaccggctct
tggagagtcttcatgcccgagttcaacagggacaagtgcgtccgctgctacctctgctac
atctactgccccgagccggcgatctacctcgacgaggagaactacccggtcttcgactac
gactactgtaagggttgtggaatctgcgccaacgagtgcccgaccgacgcgataataatg
gttagggagaccaagtga

DBGET integrated database retrieval system