KEGG   Thermococcus sp. AM4: TAM4_1398Help
Entry
TAM4_1398         CDS       T01638                                 

Definition
ketoisovalerate oxidoreductase subunit VorB
Orthology
K00187  
2-oxoisovalerate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.7]
Organism
tha  Thermococcus sp. AM4
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:tha00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1659199..1660134)
Genome map
AA seq 311 aa AA seqDB search
MEIPESIKKRLTIPAEEHFFAGHTACQGCGASLGLRYVLKAYGRKTIFVIPACCSTIIAG
AWPYNTLDANLFHTAFETTGAVISGIEAALKARGIKVKGEDGVMVVGWAGDGGTADIGLQ
ALSGFLERGHDALYIMYDNEAYMNTGIQRSGSTPYGAWTTNTPGGKRHFLEKRHKKKVID
IVIAHEVPYAATASVAFPEDFIRKLKKARKIEGPSFIQLFAPCPTGWRSPTDKSIELARL
AVQTAYFPLFEYENGKYRINMPSPKKEPKPIEEYLKLQGRFKYMTKEDVEILQQWVLHEW
EKLKKLAEVFG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagattcccgagagcattaagaaaaggttgaccattcccgctgaggagcacttcttt
gccggccacaccgcctgccagggctgcggcgcctcactcggacttcgatacgtcctcaag
gcctacggcagaaagaccatcttcgtcatcccggcgtgctgttcgacaatcatagccggt
gcgtggccatacaacaccctcgacgcgaacctcttccacaccgccttcgagaccaccggt
gcggtcataagcggtatcgaggccgctttgaaggcgagggggataaaggtcaagggcgaa
gacggcgttatggtcgtcggctgggccggcgacggtggtacagcggacataggccttcag
gccctgagcggtttcctcgagaggggccacgacgcgctctacataatgtacgacaacgag
gcctacatgaacacgggaatacagcgttcgggctcaaccccctacggagcctggaccaca
aacacgccgggaggaaagaggcacttcctcgagaagaggcacaagaagaaggtcattgac
atcgtcattgcccacgaggtcccctacgccgcgaccgcgagcgtcgccttcccggaggac
ttcataaggaagctcaagaaggcgaggaagatagaggggccgagcttcatccagctcttc
gcgccctgtccgaccggctggcgctcgccgaccgacaagagcatcgagctcgcaaggctc
gccgttcagacggcatacttcccgctcttcgagtacgagaacggcaagtacaggataaac
atgcccagtccaaagaaggagccgaagccgattgaggagtacctcaagctccagggccgc
ttcaagtacatgaccaaggaagatgtagagatcctccagcagtgggtgctccacgagtgg
gagaagcttaagaagctcgccgaggtgttcggctga

DBGET integrated database retrieval system