KEGG   Thermococcus sp. AM4: TAM4_1436Help
Entry
TAM4_1436         CDS       T01638                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tha  Thermococcus sp. AM4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TAM4_1436
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TAM4_1436
   00620 Pyruvate metabolism
    TAM4_1436
   00640 Propanoate metabolism
    TAM4_1436
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TAM4_1436
   00680 Methane metabolism
    TAM4_1436
Enzymes [BR:tha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TAM4_1436
Lipid biosynthesis proteins [BR:tha01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TAM4_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1624874..1626814)
Genome map
AA seq 646 aa AA seqDB search
MQIGEGFLKERYLPMKAFREEHRKSIENIEEFWAEQAKVLDWFKTWEKVLDDSKAPFFRW
FVGGQLNASYNALDRHVKAGKRNRAAIIWESERGETRTLTYYELYREVNRFASALKNLGV
EKGDRVVIYMPLVPEVVIAMLASARIGAIHSVVFSGFSAEALATRINDAKAKVVITADYL
YRRGKKLNLKEIVDKALLETPSVESVVVLRREENGVNMVEGRDYDWNELLDGAERYVEPV
PVESNHPLFILYTSGTTGKPKGIVHSTGGYLVYVAKTMEWAWGITESDLFWNTADVGWIT
GHSYLVYGPLTLGLTVMMYEGALNYPKPDRPWELVEKHGVTIFYTAPTAIRMLMRYGDEW
VKKHDLSSLRLLGSVGEPINPRAWKWYYEVVGGGRCPIIDTWWQTETGGYMIYPSAGIQL
PPLKPGSATFPGLGVDADVLRADGSLAEPNERGYLVIKKPWPGMLLGIWGDDERYIRTYW
KRFSRPDEGIWIYYPADYAMKDDEGYFWIFGRADEVLNVSGHRIGTAEIEHALVLHPAVA
EAAVIGRPDEIKGEVPVAFVILKENCVPRESLKKELIDYVRETLGPIAAPAEVFFVNKLP
KTRSGKIMRRVLKALASGKGLGDLSTLEDEASVEEVKKALEGFEMR
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcagataggcgaaggattcctcaaggagagatacctgccgatgaaagccttcagggag
gagcacaggaagtccatagagaacatcgaggagttctgggcagagcaggcgaaggttctc
gactggttcaagacctgggagaaggtcctcgacgactcaaaggcgcccttcttccgctgg
ttcgtcggaggtcagctcaacgcgagctacaacgccctcgacaggcacgttaaggcagga
aagagaaaccgggccgcgataatctgggagagcgagcgcggtgagacgagaacgctcacc
tactacgagctctaccgcgaggtgaaccgctttgcctcggccctgaaaaacctcggcgtc
gagaagggcgacagggtcgtcatctacatgcccctcgtcccggaggttgtcatagcaatg
ctcgccagcgcgaggattggagcgattcacagcgtcgtcttctccggcttctcggcggaa
gcattagcaacgagaatcaacgacgccaaagccaaggtcgtaataacggcagactacctc
tacaggcgcggtaagaagctcaacctcaaggagatagttgacaaggccctcctcgaaacg
ccgagcgtcgaaagcgtcgtcgtcctcaggagggaggagaacggcgtcaacatggtcgag
ggcagggactacgactggaacgaactcctcgacggggccgagcgctacgttgagcccgtt
ccggtcgagagcaaccacccgttattcatcctctacacgagtggaacaaccggaaagccc
aagggaatcgtccactccaccggcggctacctcgtctacgtggcaaagacgatggagtgg
gcgtggggaataaccgagagcgacctcttctggaacaccgcagatgttggctggataacg
ggccacagttacctcgtctacgggcccttaacgctcggcctgaccgtgatgatgtacgaa
ggtgccttgaactatccaaagcccgacaggccctgggagctggtggagaagcacggggta
acgatattctacacagccccaacagcaatcagaatgctcatgcgctacggcgacgagtgg
gtgaagaagcacgacctctcaagtttaaggctcctcggttcggtcggcgagccgattaac
ccgagggcctggaagtggtactatgaagtcgttggcggtggaaggtgcccgataatcgac
acttggtggcagaccgagaccggtggctacatgatttatccctctgctgggatacagttg
cccccgcttaagcccggctcggctacttttccgggcctcggcgtcgatgctgacgttctc
agggccgatggaagtctggcggagccgaacgagcgcggttacctcgtgataaagaagccc
tggccgggaatgctcctcggaatctggggcgacgacgagcgctacattaggacctactgg
aagcgcttcagcaggcccgacgagggaatctggatttactatccagctgactatgcgatg
aaagacgacgagggctacttctggatattcggcagggccgacgaggtgcttaacgtttcg
ggccacagaattgggacggccgagatagagcatgctttggtcctccacccggcagttgcc
gaggcggcagtaatcggaaggcccgacgagattaagggcgaagtgccggtggcttttgta
atcctcaaggagaactgcgttccgagggagagcctgaagaaggaactcatagactacgtc
agggaaaccctcggaccgatagcggctccggcggaggtattcttcgtcaacaaactgccg
aagacgaggagcgggaagataatgcgtcgcgtcctaaaggccctcgccagcggaaaggga
ctcggcgacctctcaacgctggaagatgaggcgagcgtggaagaagtgaaaaaagcttta
gaaggcttcgagatgcgctga

DBGET integrated database retrieval system